(data stored in ACNUC7421 zone)

EMBL: CP002355.PE33

CP002355.PE33        Location/Qualifiers
FT   CDS             complement(33637..33981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0033"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abi:Aboo_1244 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32701"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW85"
FT                   /protein_id="ADR32701.1"
FT                   /translation="MKLIVLSVFLALHCWGENLTVTLHYGDAKPDKVIETAYSRGMSAL
FT                   DVLKRISRVETSKTGQYRFVRSIDGVRSQIGKFGWFYLIDGESVNTTAENFILNDAKTM
FT                   TWIYKVEACY"
     MKLIVLSVFL ALHCWGENLT VTLHYGDAKP DKVIETAYSR GMSALDVLKR ISRVETSKTG        60
     QYRFVRSIDG VRSQIGKFGW FYLIDGESVN TTAENFILND AKTMTWIYKV EACY             114
//

If you have problems or comments...

PBIL Back to PBIL home page