(data stored in ACNUC7421 zone)

EMBL: CP002355.PE330

CP002355.PE330       Location/Qualifiers
FT   CDS             326266..327810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0331"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /note="COGs: COG0519 GMP synthase PP-ATPase domain/subunit;
FT                   InterProIPR004739: IPR001674: IPR000991: IPR011702: IPR
FT                   001317: IPR006220: IPR017926; KEGG: tdn:Suden_0422 GMP
FT                   synthase; PFAM: GMP synthase domain protein; glutamine
FT                   amidotransferase class-I; SPTR: GMP synthase; TIGRFAM: GMP
FT                   synthase, large subunit; GMP synthase, small subunit;
FT                   manually curated; PFAM: Glutamine amidotransferase class-I;
FT                   GMP synthase C terminal domain; tRNA methyl transferase;
FT                   TIGRFAM: GMP synthase (glutamine-hydrolyzing), C-terminal
FT                   domain or B subunit; GMP synthase (glutamine-hydrolyzing),
FT                   N-terminal domain or A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32998"
FT                   /db_xref="GOA:E4TYM1"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYM1"
FT                   /protein_id="ADR32998.1"
FT                   /translation="MKDVNIIVLDFGSQYTQLIARRLREDKVYCEVLPYHTKIDAIKAK
FT                   NPKGIILSGGPSSVYNKDAYEVDQGVYALGIPVLGICYGMQRIAVDFGGSVIRSDHHEY
FT                   GKAELTIDMTQHSVLFEGCEDERTVWMSHSDKVDVLPEGFVPIAYSPNSPYAAIANEEK
FT                   MVYAMQYHPEVNHSEEGYLMLRNFARKICGITEKWDMGHFLKEQIVKIRAQVGEGKVLC
FT                   ALSGGVDSSVVAALLYEAIGDQLIPVFVDNGLLRKGERESVENIFKVHLKVPLVVADAS
FT                   EIFLGKLAGVTDPETKRKIIGHTFIEVFEAEAKKHDGIKFLAQGTLYPDVIESVSVNGP
FT                   SVTIKSHHNVGGLPDWMDFELIEPLRDLFKDEVRKLGLELGLPDSLVNRHPFPGPGLGI
FT                   RIMGEVNKPDLNLLREADAILLDELKASGYYTKTWQAFAVLLNVKSVGVMGDNRTYDNT
FT                   VCVRVVEAVDGMTATFAHLPHTLLERISRRIINEVDGINRVVYDISSKPPATIEWE"
     MKDVNIIVLD FGSQYTQLIA RRLREDKVYC EVLPYHTKID AIKAKNPKGI ILSGGPSSVY        60
     NKDAYEVDQG VYALGIPVLG ICYGMQRIAV DFGGSVIRSD HHEYGKAELT IDMTQHSVLF       120
     EGCEDERTVW MSHSDKVDVL PEGFVPIAYS PNSPYAAIAN EEKMVYAMQY HPEVNHSEEG       180
     YLMLRNFARK ICGITEKWDM GHFLKEQIVK IRAQVGEGKV LCALSGGVDS SVVAALLYEA       240
     IGDQLIPVFV DNGLLRKGER ESVENIFKVH LKVPLVVADA SEIFLGKLAG VTDPETKRKI       300
     IGHTFIEVFE AEAKKHDGIK FLAQGTLYPD VIESVSVNGP SVTIKSHHNV GGLPDWMDFE       360
     LIEPLRDLFK DEVRKLGLEL GLPDSLVNRH PFPGPGLGIR IMGEVNKPDL NLLREADAIL       420
     LDELKASGYY TKTWQAFAVL LNVKSVGVMG DNRTYDNTVC VRVVEAVDGM TATFAHLPHT       480
     LLERISRRII NEVDGINRVV YDISSKPPAT IEWE                                   514
//

If you have problems or comments...

PBIL Back to PBIL home page