(data stored in ACNUC7421 zone)

EMBL: CP002355.PE332

CP002355.PE332       Location/Qualifiers
FT   CDS             328811..330079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0333"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="COGs: COG0151 Phosphoribosylamine-glycine ligase;
FT                   InterProIPR000115: IPR020562: IPR020561: IPR020560: IPR
FT                   020559: IPR011761; KEGG: tdn:Suden_0424
FT                   phosphoribosylamine--glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, N-domain;
FT                   Phosphoribosylglycinamide synthetase, C-domain; PRIAM:
FT                   Phosphoribosylamine--glycine ligase; SPTR:
FT                   Phosphoribosylamine--glycine ligase; TIGRFAM:
FT                   phosphoribosylamine/glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, N domain;
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, C domain; TIGRFAM:
FT                   phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33000"
FT                   /db_xref="GOA:E4TZ01"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ01"
FT                   /protein_id="ADR33000.1"
FT                   /translation="MRVMVIGSGGREFAIGRVLKQDSAVTELFFAPGNGATTMLGQNVA
FT                   IKDYGELAQFALDNKIDLTIVGPEGPLSDGVVDVFKAKGLVIFGPSKAAAQLEGSKVYM
FT                   KNFLAKYNIPTARYIETDHIGDAFKFIESLTPPIVVKADGLCAGKGVIIAMSYEEAKVA
FT                   VSEMLSGKSFGDAGKRVVVEEFLDGYELSMFALCDGKDFILLPAAQDHKRLLDNDEGPN
FT                   TGGMGAYAPTPLVDDVIYEKVKDRIVRPTLKGMQEEGAPFEGVLFIGLMIVNGEPITLE
FT                   FNVRFGDPECEILMPLLKTPASELFYKAATKQLDTLNVEFYDKYAVGVVMASRNYPYDN
FT                   SEPAEIIVDEIHHAEIAQNTHIAYAGVAAEDGKLYATGGRVLVCVGVGESIKEARDRAY
FT                   MLCGQVHFAGKKLRSDIAYQALR"
     MRVMVIGSGG REFAIGRVLK QDSAVTELFF APGNGATTML GQNVAIKDYG ELAQFALDNK        60
     IDLTIVGPEG PLSDGVVDVF KAKGLVIFGP SKAAAQLEGS KVYMKNFLAK YNIPTARYIE       120
     TDHIGDAFKF IESLTPPIVV KADGLCAGKG VIIAMSYEEA KVAVSEMLSG KSFGDAGKRV       180
     VVEEFLDGYE LSMFALCDGK DFILLPAAQD HKRLLDNDEG PNTGGMGAYA PTPLVDDVIY       240
     EKVKDRIVRP TLKGMQEEGA PFEGVLFIGL MIVNGEPITL EFNVRFGDPE CEILMPLLKT       300
     PASELFYKAA TKQLDTLNVE FYDKYAVGVV MASRNYPYDN SEPAEIIVDE IHHAEIAQNT       360
     HIAYAGVAAE DGKLYATGGR VLVCVGVGES IKEARDRAYM LCGQVHFAGK KLRSDIAYQA       420
     LR                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page