(data stored in ACNUC7421 zone)

EMBL: CP002355.PE334

CP002355.PE334       Location/Qualifiers
FT   CDS             330521..332659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0335"
FT                   /product="Organic solvent tolerance protein"
FT                   /note="COGs: COG1452 Organic solvent tolerance protein
FT                   OstA; InterPro IPR007543; KEGG: tdn:Suden_0426 organic
FT                   solvent tolerance protein, putative; PFAM: Organic solvent
FT                   tolerance protein; SPTR: Organic solvent tolerance protein,
FT                   putative; PFAM: Organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33002"
FT                   /db_xref="GOA:E4TZ03"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ03"
FT                   /protein_id="ADR33002.1"
FT                   /translation="MHKFYWISLIASTALLGNERVELFGTNMDSNGSVATAQGNPIALY
FT                   QDQIMSADKVTYDRNTSIMEAKGSVNVFKDGQHVMSEYSRINFLDETRYSVPYFAIDQS
FT                   TGLWVSTSEAQACKNLIDLSSGAISGCDSSDPLWKIRFSSADYDTDKMWVNLYNPRLEI
FT                   GDISVFYLPYFGYPTDSTRRSGLLIPTFGWSSSEGFYYQQPIYFAPQNWWDLELRPQIR
FT                   TARGSGLYTDFRFVDTPSSQGSIRMGYFKEQSRYAIENDLAHAKHYGYDVKYRHSAPLR
FT                   EWFDSTLEGESGIYIDGSWMNDVDYLNLQQSDETRNITANQVMSRINGYYSSEDNYFGA
FT                   YFKHYQYLNSASNGTTIQTLPTLQYHRYLESFLDNYLLISADAAATHYYRPNGKRAVEG
FT                   NFNIPATLQTSILDDYIDISYTANASAKVIGFYANERNGESGSTYEQGKYAQLDHTLSI
FT                   GSTLVKSYDNNITHVFNPLVSYTAAGSRYYSGYYETYRNSCNMSESYAGYPCEFYNLSA
FT                   PSDTLSLGINNYLFENGKQLLVDRLSQNFRYDDQRSYYGELQNELELEIAGAISYYNQT
FT                   AYNYDRDRITKEQNTIRYNDGVFLAGISHYYTDQLRNDTPVYASYWTADAAYQYSRNYR
FT                   FFGQVAYDYREALLKRSEVGLLYSQRCFDFGVRYVQNRRPILTNTNGSDSINDSYIFIT
FT                   VVLKPIGGSEFNYKLTDN"
     MHKFYWISLI ASTALLGNER VELFGTNMDS NGSVATAQGN PIALYQDQIM SADKVTYDRN        60
     TSIMEAKGSV NVFKDGQHVM SEYSRINFLD ETRYSVPYFA IDQSTGLWVS TSEAQACKNL       120
     IDLSSGAISG CDSSDPLWKI RFSSADYDTD KMWVNLYNPR LEIGDISVFY LPYFGYPTDS       180
     TRRSGLLIPT FGWSSSEGFY YQQPIYFAPQ NWWDLELRPQ IRTARGSGLY TDFRFVDTPS       240
     SQGSIRMGYF KEQSRYAIEN DLAHAKHYGY DVKYRHSAPL REWFDSTLEG ESGIYIDGSW       300
     MNDVDYLNLQ QSDETRNITA NQVMSRINGY YSSEDNYFGA YFKHYQYLNS ASNGTTIQTL       360
     PTLQYHRYLE SFLDNYLLIS ADAAATHYYR PNGKRAVEGN FNIPATLQTS ILDDYIDISY       420
     TANASAKVIG FYANERNGES GSTYEQGKYA QLDHTLSIGS TLVKSYDNNI THVFNPLVSY       480
     TAAGSRYYSG YYETYRNSCN MSESYAGYPC EFYNLSAPSD TLSLGINNYL FENGKQLLVD       540
     RLSQNFRYDD QRSYYGELQN ELELEIAGAI SYYNQTAYNY DRDRITKEQN TIRYNDGVFL       600
     AGISHYYTDQ LRNDTPVYAS YWTADAAYQY SRNYRFFGQV AYDYREALLK RSEVGLLYSQ       660
     RCFDFGVRYV QNRRPILTNT NGSDSINDSY IFITVVLKPI GGSEFNYKLT DN               712
//

If you have problems or comments...

PBIL Back to PBIL home page