(data stored in ACNUC7421 zone)

EMBL: CP002355.PE335

CP002355.PE335       Location/Qualifiers
FT   CDS             332674..334053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0336"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="COGs: COG1463 ABC-type transport system involved in
FT                   resistance to organic solvents periplasmic component;
FT                   InterPro IPR003399; KEGG: nis:NIS_1335 hypothetical
FT                   protein; PFAM: Mammalian cell entry related domain protein;
FT                   SPTR: Putative uncharacterized protein; PFAM: mce related
FT                   protein; TIGRFAM: virulence factor Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33003"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ04"
FT                   /protein_id="ADR33003.1"
FT                   /translation="MKLEAKIGLFVVMALGALLFLSTQVTSLGKWGSEGYVIQAYINDA
FT                   SGIEKHTHVLMNGVTIGDVEEITIEGKRVKLQLMIDKGVKIPVDSSVIVAQESLLGSKV
FT                   LNITVGDSASSIADGGTLSQSKQFASFDQTSDSVNAAAKELESLLRDFHAILDDEHRQA
FT                   IQEAIIAFRNVGVNLDGVIVENRDDLHAAIANFRAMGAGFTQTADTVNKDLPEIMARIN
FT                   SLTAQLDSKLPTAVDKFTNIEDNVSTILAENRSTLKTTLESAGSFFKSGEEAFGKVDSM
FT                   LSSFTTSELQVAMHTDYMMRDQYGKVYLGVNYLPNPETYYMFDLISTDDYSDANNPPKK
FT                   HQKSDTLYSLQYGKRFDNTLLRFGAIESTGGIGVDYFMNHDKLKLSAEAFDFNSVNDYR
FT                   SERAHLKAQVRYQMLKHLELYGGWDDFLNPKSQNIFLGLGLRFIDNDLKYVVGGASSMK
FT                   R"
     MKLEAKIGLF VVMALGALLF LSTQVTSLGK WGSEGYVIQA YINDASGIEK HTHVLMNGVT        60
     IGDVEEITIE GKRVKLQLMI DKGVKIPVDS SVIVAQESLL GSKVLNITVG DSASSIADGG       120
     TLSQSKQFAS FDQTSDSVNA AAKELESLLR DFHAILDDEH RQAIQEAIIA FRNVGVNLDG       180
     VIVENRDDLH AAIANFRAMG AGFTQTADTV NKDLPEIMAR INSLTAQLDS KLPTAVDKFT       240
     NIEDNVSTIL AENRSTLKTT LESAGSFFKS GEEAFGKVDS MLSSFTTSEL QVAMHTDYMM       300
     RDQYGKVYLG VNYLPNPETY YMFDLISTDD YSDANNPPKK HQKSDTLYSL QYGKRFDNTL       360
     LRFGAIESTG GIGVDYFMNH DKLKLSAEAF DFNSVNDYRS ERAHLKAQVR YQMLKHLELY       420
     GGWDDFLNPK SQNIFLGLGL RFIDNDLKYV VGGASSMKR                              459
//

If you have problems or comments...

PBIL Back to PBIL home page