(data stored in ACNUC7421 zone)

EMBL: CP002355.PE336

CP002355.PE336       Location/Qualifiers
FT   CDS             334069..336246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0337"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="COGs: COG1185 Polyribonucleotide
FT                   nucleotidyltransferase (polynucleotide phosphorylase);
FT                   InterProIPR012162: IPR001247: IPR015847: IPR015848: IPR
FT                   018111: IPR003029: IPR004087: IPR004088; KEGG:
FT                   tdn:Suden_0428 polynucleotide phosphorylase/polyadenylase;
FT                   PFAM: 3' exoribonuclease; Exoribonuclease, phosphorolytic
FT                   domain 2; Polynucleotide phosphorylase, phosphorolytic
FT                   RNA-binding; K Homology, type 1, subgroup; RNA binding S1
FT                   domain protein; PRIAM: Polyribonucleotide
FT                   nucleotidyltransferase; SMART: KH domain protein; SPTR:
FT                   Polyribonucleotide nucleotidyltransferase; TIGRFAM:
FT                   polyribonucleotide nucleotidyltransferase; PFAM: KH domain;
FT                   S1 RNA binding domain; 3' exoribonuclease family, domain 1;
FT                   3' exoribonuclease family, domain 2; Polyribonucleotide
FT                   nucleotidyltransferase, RNA binding domain; TIGRFAM:
FT                   polyribonucleotide nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33004"
FT                   /db_xref="GOA:E4TZ05"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ05"
FT                   /protein_id="ADR33004.1"
FT                   /translation="MKYNVELTLQNKTEAYAFNQVAAQANGAAWLKCGDTVILATVVID
FT                   ETDFVDEDFLPLTVQYIEKSYAAGKFPGGFIKRETKPSDFETLTSRIVDRSLRPLFPKG
FT                   FANPVQITVMVLSADREADLQVLALNAASAALYVSDIDIFNSVSAVRVGKIDGEIVFNP
FT                   TLSQLQKSTLDLYLAGSKEDMLMIEMQTLGSDEVEILDIGIIDPLVDPAMSTPSVAVRR
FT                   SNAMSEDELIRILASAQIALSEANSAYESAFKSYAKPPFELQTIVSEISGEMIEYVRSV
FT                   HTDDLKRGINQMAKTERSTALRTIRKTILKEKPEWNEHELKKAIESVKRSMVRAQILDE
FT                   KVRADGRALNEVRPISIETNVLPSAHASALFTRGQTQALVVLTLGGAKDAQMFENLTDS
FT                   GTQNEGFMVHYNFPGFSVGEPSPIGAPRRRELGHGNLAKRALEGACVRNGQTIRLVSEV
FT                   LESNGSSSMATVCGGYMALRAGDIEVADPIAGVAMGMVQEGSRHAILTDIMGLEDHDGD
FT                   LDFKVAGSKGGITAMQMDIKLGGIHLDVLKEALYQAKEARSHIIDIMISSEDKIELNEG
FT                   TLPSTDLFHIDPSFIGDIIGQAGKTIREIIERFDVTIDIDKKKGSVKLTGKNRDGLRGA
FT                   RDHIEGIVSGATPVEKVEYKVGDVVKGKVKKIVDFGAFIELPGGVDGLIHISKLSDGHV
FT                   SRVSDVVNEGDELMVEIVEFKGNKIGLGRAK"
     MKYNVELTLQ NKTEAYAFNQ VAAQANGAAW LKCGDTVILA TVVIDETDFV DEDFLPLTVQ        60
     YIEKSYAAGK FPGGFIKRET KPSDFETLTS RIVDRSLRPL FPKGFANPVQ ITVMVLSADR       120
     EADLQVLALN AASAALYVSD IDIFNSVSAV RVGKIDGEIV FNPTLSQLQK STLDLYLAGS       180
     KEDMLMIEMQ TLGSDEVEIL DIGIIDPLVD PAMSTPSVAV RRSNAMSEDE LIRILASAQI       240
     ALSEANSAYE SAFKSYAKPP FELQTIVSEI SGEMIEYVRS VHTDDLKRGI NQMAKTERST       300
     ALRTIRKTIL KEKPEWNEHE LKKAIESVKR SMVRAQILDE KVRADGRALN EVRPISIETN       360
     VLPSAHASAL FTRGQTQALV VLTLGGAKDA QMFENLTDSG TQNEGFMVHY NFPGFSVGEP       420
     SPIGAPRRRE LGHGNLAKRA LEGACVRNGQ TIRLVSEVLE SNGSSSMATV CGGYMALRAG       480
     DIEVADPIAG VAMGMVQEGS RHAILTDIMG LEDHDGDLDF KVAGSKGGIT AMQMDIKLGG       540
     IHLDVLKEAL YQAKEARSHI IDIMISSEDK IELNEGTLPS TDLFHIDPSF IGDIIGQAGK       600
     TIREIIERFD VTIDIDKKKG SVKLTGKNRD GLRGARDHIE GIVSGATPVE KVEYKVGDVV       660
     KGKVKKIVDF GAFIELPGGV DGLIHISKLS DGHVSRVSDV VNEGDELMVE IVEFKGNKIG       720
     LGRAK                                                                   725
//

If you have problems or comments...

PBIL Back to PBIL home page