(data stored in ACNUC7421 zone)

EMBL: CP002355.PE337

CP002355.PE337       Location/Qualifiers
FT   CDS             336339..336716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0338"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /note="InterPro IPR005953: IPR002379: IPR000454: IPR020537;
FT                   KEGG: tdn:Suden_0429 F0F1 ATP synthase subunit C; PFAM:
FT                   H+transporting two-sector ATPase C subunit; SPTR: ATP
FT                   synthase C chain; TIGRFAM: ATP synthase F0, C subunit;
FT                   PFAM: ATP synthase subunit C; TIGRFAM: ATP synthase, F0
FT                   subunit c"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33005"
FT                   /db_xref="GOA:E4TZ06"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ06"
FT                   /protein_id="ADR33005.1"
FT                   /translation="MKKVFFLMLALVASVFGADEAVAAVETAVEAAPAVAAASADVANQ
FT                   TLKAYSMIAAGVGLGLAALGGAIGMGSTAAATIAGTARNPGLGGKLMTTMFIALAMIEA
FT                   QVIYTLVIALIALYANPYLAA"
     MKKVFFLMLA LVASVFGADE AVAAVETAVE AAPAVAAASA DVANQTLKAY SMIAAGVGLG        60
     LAALGGAIGM GSTAAATIAG TARNPGLGGK LMTTMFIALA MIEAQVIYTL VIALIALYAN       120
     PYLAA                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page