(data stored in ACNUC7421 zone)

EMBL: CP002355.PE338

CP002355.PE338       Location/Qualifiers
FT   CDS             336975..337322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0339"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1089 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33006"
FT                   /db_xref="InterPro:IPR013502"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ07"
FT                   /protein_id="ADR33006.1"
FT                   /translation="MAYITQLKHLIQNELIPDVEEHIDDIFESIASQKDATVEERAQLE
FT                   DMQALRDEYKDLLKELNSGDIDEEEAEQLYTELTSMREGEGDEDDDYFDEEDEDEDDYD
FT                   EFDLEDEDNQY"
     MAYITQLKHL IQNELIPDVE EHIDDIFESI ASQKDATVEE RAQLEDMQAL RDEYKDLLKE        60
     LNSGDIDEEE AEQLYTELTS MREGEGDEDD DYFDEEDEDE DDYDEFDLED EDNQY            115
//

If you have problems or comments...

PBIL Back to PBIL home page