(data stored in ACNUC7421 zone)

EMBL: CP002355.PE339

CP002355.PE339       Location/Qualifiers
FT   CDS             337322..338065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0340"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="COGs: COG0847 DNA polymerase III epsilon subunit and
FT                   related 3'-5' exonuclease; InterPro IPR013520: IPR006055;
FT                   KEGG: tdn:Suden_1790 exonuclease; PFAM: Exonuclease RNase T
FT                   and DNA polymerase III; SMART: Exonuclease; SPTR:
FT                   Exonuclease; PFAM: Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33007"
FT                   /db_xref="GOA:E4TZ08"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ08"
FT                   /protein_id="ADR33007.1"
FT                   /translation="MAKYILLDTETTGAGDDDRIIQLGYMVLDGKNVEVYNEMCSTEVA
FT                   ISYGAMEVHGITPEMIEGKPSCRETSAFQKLCELNTSDNVLIIHNAPFDLGMLTKENFS
FT                   SQMRLIDTLRCARHLFDEEESHRLQYFRYRLGLYKIEQDEAESLGIEVKAHDAIGDVLV
FT                   LKLFLTELRKRLQERYEGANPIDKMVELTKTPVFYTRALKFGKYKGKTLTEIADMDKGY
FT                   LNWMLGNMDSLDEDMRYSIERVLTS"
     MAKYILLDTE TTGAGDDDRI IQLGYMVLDG KNVEVYNEMC STEVAISYGA MEVHGITPEM        60
     IEGKPSCRET SAFQKLCELN TSDNVLIIHN APFDLGMLTK ENFSSQMRLI DTLRCARHLF       120
     DEEESHRLQY FRYRLGLYKI EQDEAESLGI EVKAHDAIGD VLVLKLFLTE LRKRLQERYE       180
     GANPIDKMVE LTKTPVFYTR ALKFGKYKGK TLTEIADMDK GYLNWMLGNM DSLDEDMRYS       240
     IERVLTS                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page