(data stored in ACNUC7421 zone)

EMBL: CP002355.PE34

CP002355.PE34        Location/Qualifiers
FT   CDS             complement(33981..35828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0034"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="COGs: COG4206 Outer membrane cobalamin receptor
FT                   protein; InterPro IPR012910: IPR000531; KEGG: sdl:Sdel_1459
FT                   TonB-dependent receptor; PFAM: TonB-dependent receptor
FT                   plug; TonB-dependent receptor; SPTR: TonB-dependent
FT                   receptor; PFAM: TonB dependent receptor; TonB-dependent
FT                   Receptor Plug Domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32702"
FT                   /db_xref="GOA:E4TW86"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW86"
FT                   /protein_id="ADR32702.1"
FT                   /translation="MYKQTISFVAAATLAASSLGADELSFHPIVVTATKTEQSLNTITS
FT                   NVEIITAEEIEEQHYTSLAEALNSLSGISITSNGGVGTTQEVFVRGMDTNKVLVLINGI
FT                   RYQDPSSTSGANFAHLLISDIEQIELIKGAQSGVWGADASAGVINIITKSAEAGTHTGA
FT                   NVEYGSFATTKWGGFLSHKTDKYDFKISFDRLMSSSFTAQAPKGDNIDRYEKDPYANTT
FT                   LNLNAHYNPTSEDTFGISYTDINALGSYDSYHSPNSVEHSDVRTRLYGVTYDKAYHNHT
FT                   LSTKANLSKFRRDELDTGYGVKVFNGQTREAELRDHFRYGENDFIVAGLSKKWDQIDFI
FT                   QADSTTGAKSVSSKAVFVTNSNTFGDLILTESLRRDDYSSFHAKTTGKMGAKYTLSEDM
FT                   YVGGNYGTSYTAPNLIQMFNPWGASNDTLSPENTKSYDLTLGYKSITLTYFENRVKDLI
FT                   EWYDPTPLNWFNNDPYYKNLNGISTFKGYEVTFRHTLLDAFVLNADYTHLARFVDKDGK
FT                   DLKRRPKREAKVSVNYYGIEDLSMGINAHYVGTRYDQADQQGEQTGRYTLFNFVLNYNL
FT                   TDSIQLYGKIDNLTDKYYQSVDGYASSPRGYYAGMKVIF"
     MYKQTISFVA AATLAASSLG ADELSFHPIV VTATKTEQSL NTITSNVEII TAEEIEEQHY        60
     TSLAEALNSL SGISITSNGG VGTTQEVFVR GMDTNKVLVL INGIRYQDPS STSGANFAHL       120
     LISDIEQIEL IKGAQSGVWG ADASAGVINI ITKSAEAGTH TGANVEYGSF ATTKWGGFLS       180
     HKTDKYDFKI SFDRLMSSSF TAQAPKGDNI DRYEKDPYAN TTLNLNAHYN PTSEDTFGIS       240
     YTDINALGSY DSYHSPNSVE HSDVRTRLYG VTYDKAYHNH TLSTKANLSK FRRDELDTGY       300
     GVKVFNGQTR EAELRDHFRY GENDFIVAGL SKKWDQIDFI QADSTTGAKS VSSKAVFVTN       360
     SNTFGDLILT ESLRRDDYSS FHAKTTGKMG AKYTLSEDMY VGGNYGTSYT APNLIQMFNP       420
     WGASNDTLSP ENTKSYDLTL GYKSITLTYF ENRVKDLIEW YDPTPLNWFN NDPYYKNLNG       480
     ISTFKGYEVT FRHTLLDAFV LNADYTHLAR FVDKDGKDLK RRPKREAKVS VNYYGIEDLS       540
     MGINAHYVGT RYDQADQQGE QTGRYTLFNF VLNYNLTDSI QLYGKIDNLT DKYYQSVDGY       600
     ASSPRGYYAG MKVIF                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page