(data stored in ACNUC7421 zone)

EMBL: CP002355.PE340

CP002355.PE340       Location/Qualifiers
FT   CDS             complement(338079..338513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0341"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lic:LIC13293 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33008"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ09"
FT                   /protein_id="ADR33008.1"
FT                   /translation="MIDALQEHRLHYQETLFNAVNPYHYRFTRYHANYSVVLAYISEES
FT                   GDLTACGDYLRGSDSIIYFRSNFCAIIFDSTNEEQGIKAANNVFSRVQARFFSKHFYMT
FT                   VITATDEKSEFQMIHDLFDLMSYALEHNMDNLVLDSSQVI"
     MIDALQEHRL HYQETLFNAV NPYHYRFTRY HANYSVVLAY ISEESGDLTA CGDYLRGSDS        60
     IIYFRSNFCA IIFDSTNEEQ GIKAANNVFS RVQARFFSKH FYMTVITATD EKSEFQMIHD       120
     LFDLMSYALE HNMDNLVLDS SQVI                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page