(data stored in ACNUC7421 zone)

EMBL: CP002355.PE341

CP002355.PE341       Location/Qualifiers
FT   CDS             complement(338588..338848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0342"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="InterPro IPR006597; KEGG: sun:SUN_2411 hypothetical
FT                   protein; PFAM: Sel1 domain protein repeat-containing
FT                   protein; SMART: Sel1 domain protein repeat-containing
FT                   protein; SPTR: Putative uncharacterized protein; PFAM: Sel1
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33009"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ10"
FT                   /protein_id="ADR33009.1"
FT                   /translation="MDDLFAGIAAYDAGDYTKAHEILYPLAAYKRDPEAQFHMGMIYFY
FT                   GEGVEKDIDKAMEWWKKAMRNGHVDAAYRLSEIATSTKTTF"
     MDDLFAGIAA YDAGDYTKAH EILYPLAAYK RDPEAQFHMG MIYFYGEGVE KDIDKAMEWW        60
     KKAMRNGHVD AAYRLSEIAT STKTTF                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page