(data stored in ACNUC7421 zone)

EMBL: CP002355.PE342

CP002355.PE342       Location/Qualifiers
FT   CDS             338918..340174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0343"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1783 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33010"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ11"
FT                   /protein_id="ADR33010.1"
FT                   /translation="MRAMNYNELSGKSILLLGKTRALNAEEFDTLLKLHKIERAEHCNH
FT                   DVALIIEGRMMNPYEQEELAHLYETQQIPIVELSTIEEWLCRSIEPNRLLMSLKLSRNQ
FT                   ERLVDFLQNPYISDTLFFKLLKLYDWQNEGLFDNDMNRDVTASIIGRFYEDLDRNHNVQ
FT                   YAMSGLAHLIERYGNADLIDAIADISPISRELKNPSDRSLTGILDAMALHSDTSEPILR
FT                   LLMSGRAKLLAHREPLGLENELLMLGDEEVNTILSQNRTLSKEGADVLEASHPHLIASN
FT                   TVLCDTRFDRLIGKYASYLASNPSLSPAMQQRLFESKDGNVLDVLASNPIIQREILDRL
FT                   FESGRFSMQLAKNSALSQENIKILFLRGESEVLSALAANVSTPIEILYQLSLDQRFERR
FT                   VKTNPAFGKYIQTHNIGWS"
     MRAMNYNELS GKSILLLGKT RALNAEEFDT LLKLHKIERA EHCNHDVALI IEGRMMNPYE        60
     QEELAHLYET QQIPIVELST IEEWLCRSIE PNRLLMSLKL SRNQERLVDF LQNPYISDTL       120
     FFKLLKLYDW QNEGLFDNDM NRDVTASIIG RFYEDLDRNH NVQYAMSGLA HLIERYGNAD       180
     LIDAIADISP ISRELKNPSD RSLTGILDAM ALHSDTSEPI LRLLMSGRAK LLAHREPLGL       240
     ENELLMLGDE EVNTILSQNR TLSKEGADVL EASHPHLIAS NTVLCDTRFD RLIGKYASYL       300
     ASNPSLSPAM QQRLFESKDG NVLDVLASNP IIQREILDRL FESGRFSMQL AKNSALSQEN       360
     IKILFLRGES EVLSALAANV STPIEILYQL SLDQRFERRV KTNPAFGKYI QTHNIGWS         418
//

If you have problems or comments...

PBIL Back to PBIL home page