(data stored in ACNUC7421 zone)

EMBL: CP002355.PE345

CP002355.PE345       Location/Qualifiers
FT   CDS             342232..343470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0346"
FT                   /product="AAA ATPase"
FT                   /note="COGs: COG0507 ATP-dependent exoDNAse (exonuclease V)
FT                   alpha subunit - helicase superfamily I member; InterPro
FT                   IPR003593; KEGG: tdn:Suden_1779 ATPase; SMART: AAA ATPase;
FT                   SPTR: ATPase; PFAM: PIF1 helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33013"
FT                   /db_xref="GOA:E4TZ14"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ14"
FT                   /protein_id="ADR33013.1"
FT                   /translation="MVENALKILETSNLFITGGAGSGKTTLTRALIDDAVQKGKSVARL
FT                   ASTGMAATLIGGQTLHSFFDLGIANSQQELERNGKLEPAKKIIKLIRSMQIIVIDEISM
FT                   VGAQLLDMIRLRLLQAEFSGRLIVVGDFLQLPPVTRGIEPIYFAFESPSWERFGFETIH
FT                   LEGSYRTHEAEFLSLLEQVRHARIDEAAINALDELVKPLSEDMSSVTLLFGKNISAQNH
FT                   NRSQLEHLHGDIVELSTYVTIHDKKMQERDIERFMVESRIEPALALKVGAPILFTRNAW
FT                   NYYNGERGMITSIEEDVIWVKKSDGVSVKVERVDTIKTRWVEKGNTASEEKLISLSQFP
FT                   ITLAFAITIHKSQGMSLADYVIETNEIFAPSQFYVALSRSVSAHRVTLIRPNRGWEKLC
FT                   FVHPKAKRFSDSV"
     MVENALKILE TSNLFITGGA GSGKTTLTRA LIDDAVQKGK SVARLASTGM AATLIGGQTL        60
     HSFFDLGIAN SQQELERNGK LEPAKKIIKL IRSMQIIVID EISMVGAQLL DMIRLRLLQA       120
     EFSGRLIVVG DFLQLPPVTR GIEPIYFAFE SPSWERFGFE TIHLEGSYRT HEAEFLSLLE       180
     QVRHARIDEA AINALDELVK PLSEDMSSVT LLFGKNISAQ NHNRSQLEHL HGDIVELSTY       240
     VTIHDKKMQE RDIERFMVES RIEPALALKV GAPILFTRNA WNYYNGERGM ITSIEEDVIW       300
     VKKSDGVSVK VERVDTIKTR WVEKGNTASE EKLISLSQFP ITLAFAITIH KSQGMSLADY       360
     VIETNEIFAP SQFYVALSRS VSAHRVTLIR PNRGWEKLCF VHPKAKRFSD SV               412
//

If you have problems or comments...

PBIL Back to PBIL home page