(data stored in ACNUC7421 zone)

EMBL: CP002355.PE346

CP002355.PE346       Location/Qualifiers
FT   CDS             complement(343727..344473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0347"
FT                   /product="Conserved hypothetical protein CHP00245"
FT                   /note="COGs: COG0390 ABC-type uncharacterized transport
FT                   system permease component; InterPro IPR005226; KEGG:
FT                   pmx:PERMA_1353 hypothetical protein; PFAM: Conserved
FT                   hypothetical protein CHP00245; SPTR: Putative membrane
FT                   protein; PFAM: Uncharacterised protein family (UPF0014);
FT                   TIGRFAM: conserved hypothetical protein TIGR00245"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33014"
FT                   /db_xref="GOA:E4TZ15"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ15"
FT                   /protein_id="ADR33014.1"
FT                   /translation="MQYSFLASYLLIVFALWYSRREQFGLEKMILTNSILAMVQLGLLG
FT                   YALVYLFQMQHPALLFFVLLGMVTFGAYTAKKRAPLGEHSFKIALFSLGASSGIVFLSM
FT                   MAFGVIHIVPHEMIPIGGMIIGNALNVYSQSIERFRAEVKNTIETIEGMVALGAPLKEA
FT                   LSFASKASVKASMIPTLNMLQTVGIIHIPGITTGMLLAGADPLKAISYQLAVMYMMVAV
FT                   ALLSAVFSVMFSYRLIVGAAFDKSKS"
     MQYSFLASYL LIVFALWYSR REQFGLEKMI LTNSILAMVQ LGLLGYALVY LFQMQHPALL        60
     FFVLLGMVTF GAYTAKKRAP LGEHSFKIAL FSLGASSGIV FLSMMAFGVI HIVPHEMIPI       120
     GGMIIGNALN VYSQSIERFR AEVKNTIETI EGMVALGAPL KEALSFASKA SVKASMIPTL       180
     NMLQTVGIIH IPGITTGMLL AGADPLKAIS YQLAVMYMMV AVALLSAVFS VMFSYRLIVG       240
     AAFDKSKS                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page