(data stored in ACNUC7421 zone)

EMBL: CP002355.PE347

CP002355.PE347       Location/Qualifiers
FT   CDS             complement(344650..345246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0348"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="COGs: COG0450 Peroxiredoxin; InterPro IPR000866:
FT                   IPR019479: IPR017936; KEGG: sdl:Sdel_0223 alkyl
FT                   hydroperoxide reductase/thiol specific antioxidant/Mal
FT                   allergen; PFAM: alkyl hydroperoxide reductase/ Thiol
FT                   specific antioxidant/ Mal allergen; Peroxiredoxin-like;
FT                   SPTR: Alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; PFAM: C-terminal domain of 1-Cys
FT                   peroxiredoxin; AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33015"
FT                   /db_xref="GOA:E4TZ16"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ16"
FT                   /protein_id="ADR33015.1"
FT                   /translation="MLVTKKAPDFTATTVLGNNQIVDNFNLYENLGEKGAVLFFYPLDF
FT                   TFVCPSEIIAFDHRLEEFTARGINVIGVSVDSQFSHFAWKNTPVKEGGIGQVRYPLVAD
FT                   LNKQISRDYDVLLGDSVALRGSFLLDKDGTIRHAVINDLPLGRNIDEMLRMIDAMLFTN
FT                   EHGEVCPAGWAKGDAGMKASTEGVAEYLSAHAETL"
     MLVTKKAPDF TATTVLGNNQ IVDNFNLYEN LGEKGAVLFF YPLDFTFVCP SEIIAFDHRL        60
     EEFTARGINV IGVSVDSQFS HFAWKNTPVK EGGIGQVRYP LVADLNKQIS RDYDVLLGDS       120
     VALRGSFLLD KDGTIRHAVI NDLPLGRNID EMLRMIDAML FTNEHGEVCP AGWAKGDAGM       180
     KASTEGVAEY LSAHAETL                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page