(data stored in ACNUC7421 zone)

EMBL: CP002355.PE348

CP002355.PE348       Location/Qualifiers
FT   CDS             345409..347175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0349"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components; InterProIPR001140:
FT                   IPR003439: IPR017871: IPR003593: IPR 017940; KEGG:
FT                   abu:Abu_1106 ABC transporter, ATP-binding protein; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase; SPTR: ABC transporter,
FT                   ATP-binding protein; PFAM: ABC transporter transmembrane
FT                   region; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33016"
FT                   /db_xref="GOA:E4TZ17"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ17"
FT                   /protein_id="ADR33016.1"
FT                   /translation="MITFKTLFGMMLRYKRSLFWGNVIAIIATLVSIPIPLLIPLMVDE
FT                   VLLEKGGTVTGVIDQLSSAHDPLIYIGIVLAVTITLRFLFFILSVVSQKFFITLSQELS
FT                   FTIRVRALEHLKHVSMSSYERLGSGKVITHLITDIDTIEQFLGSALSKLIVSVATLIGV
FT                   AVVLIWINPLFGILILIFQPLIMLVTRKISGRVGMLKKEQNRTIGELSDTLTQMCDLFG
FT                   QIRASNKEERFIDNAIDHSKRLRQSASEYGIKALMGERYSYTLFLSGFEIFRALGLVMV
FT                   LYSHLSIGLMFGIFGYLWFMMTPVQDLLSLQYSFANAKNALQRLNELLSLPTEPTANVS
FT                   AQSISASGPLSIHTENLVFGYDEKEPVLRGVNLDIHAGSTVAIIGASGSGKSTLSQLLV
FT                   GFYPPTSGDIFYNGVSVRDIGFPNVRDAVFVVLQQPLMFNDTLRFNLTMGDEIRDDEIQ
FT                   KALEIAQLSEFVSTLPDGLNTQVGKFGIRLSGGQRQRLSIARMVLAKPKAVIFDESTSA
FT                   LDVHTESKLFEALEAFLKDKTVIIIAHRLSTVTRADYIYVLENGIILEEGTRDVLEAID
FT                   GSYKRFINSQHG"
     MITFKTLFGM MLRYKRSLFW GNVIAIIATL VSIPIPLLIP LMVDEVLLEK GGTVTGVIDQ        60
     LSSAHDPLIY IGIVLAVTIT LRFLFFILSV VSQKFFITLS QELSFTIRVR ALEHLKHVSM       120
     SSYERLGSGK VITHLITDID TIEQFLGSAL SKLIVSVATL IGVAVVLIWI NPLFGILILI       180
     FQPLIMLVTR KISGRVGMLK KEQNRTIGEL SDTLTQMCDL FGQIRASNKE ERFIDNAIDH       240
     SKRLRQSASE YGIKALMGER YSYTLFLSGF EIFRALGLVM VLYSHLSIGL MFGIFGYLWF       300
     MMTPVQDLLS LQYSFANAKN ALQRLNELLS LPTEPTANVS AQSISASGPL SIHTENLVFG       360
     YDEKEPVLRG VNLDIHAGST VAIIGASGSG KSTLSQLLVG FYPPTSGDIF YNGVSVRDIG       420
     FPNVRDAVFV VLQQPLMFND TLRFNLTMGD EIRDDEIQKA LEIAQLSEFV STLPDGLNTQ       480
     VGKFGIRLSG GQRQRLSIAR MVLAKPKAVI FDESTSALDV HTESKLFEAL EAFLKDKTVI       540
     IIAHRLSTVT RADYIYVLEN GIILEEGTRD VLEAIDGSYK RFINSQHG                    588
//

If you have problems or comments...

PBIL Back to PBIL home page