(data stored in ACNUC7421 zone)

EMBL: CP002355.PE35

CP002355.PE35        Location/Qualifiers
FT   CDS             complement(35771..36031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdl:Sdel_0832 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32703"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW87"
FT                   /protein_id="ADR32703.1"
FT                   /translation="MRSPRGFGKTYFSLVAIQAYASEVRLLQIIHQIIWICPTHPIHTY
FT                   STVSPPKSVLLLSIITTITQGHLCTNKPFPSLPRQHWLPLL"
     MRSPRGFGKT YFSLVAIQAY ASEVRLLQII HQIIWICPTH PIHTYSTVSP PKSVLLLSII        60
     TTITQGHLCT NKPFPSLPRQ HWLPLL                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page