(data stored in ACNUC7421 zone)

EMBL: CP002355.PE350

CP002355.PE350       Location/Qualifiers
FT   CDS             complement(348272..348580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0351"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saf:SULAZ_1614 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33018"
FT                   /db_xref="GOA:E4TZ19"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ19"
FT                   /protein_id="ADR33018.1"
FT                   /translation="MNQDNTLSFIVGAALGGIAGYFLFKHQDQIVDKIHELEGNLNIDH
FT                   NALIDKAKHKLDALTQNVQSTIERYTHGSEDKSTDEITSIMAELAKLREEVRELKAI"
     MNQDNTLSFI VGAALGGIAG YFLFKHQDQI VDKIHELEGN LNIDHNALID KAKHKLDALT        60
     QNVQSTIERY THGSEDKSTD EITSIMAELA KLREEVRELK AI                          102
//

If you have problems or comments...

PBIL Back to PBIL home page