(data stored in ACNUC7421 zone)

EMBL: CP002355.PE351

CP002355.PE351       Location/Qualifiers
FT   CDS             complement(348590..348994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0352"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sga:GALLO_1534 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33019"
FT                   /db_xref="GOA:E4TZ20"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ20"
FT                   /protein_id="ADR33019.1"
FT                   /translation="MSEIGLLTVFVGIIALCMVIITSVVIFIGIQSSKTMQKSQELMAH
FT                   LQNELSFLATKAALTLHEVNELIGHLKEETKALSDKSKLSLHELHDLISYLHDETKTLA
FT                   LKASNGIAKVTIGSLAIGAISQFFKKKNNS"
     MSEIGLLTVF VGIIALCMVI ITSVVIFIGI QSSKTMQKSQ ELMAHLQNEL SFLATKAALT        60
     LHEVNELIGH LKEETKALSD KSKLSLHELH DLISYLHDET KTLALKASNG IAKVTIGSLA       120
     IGAISQFFKK KNNS                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page