(data stored in ACNUC7421 zone)

EMBL: CP002355.PE352

CP002355.PE352       Location/Qualifiers
FT   CDS             349133..349777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0353"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG1192 ATPase involved in chromosome
FT                   partitioning; KEGG: seh:SeHA_A0032 ParA protein homolog;
FT                   SPTR: Partitioning protein, putative; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33020"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ21"
FT                   /protein_id="ADR33020.1"
FT                   /translation="MILTLSHQKGGVGKSTVAWNLAVYFSGIMDTRIVDLDTQRSLTVT
FT                   NALRKEHNLPSIKMIHFNTAEELAEYAAADSDDVLTIIDSGGFDSAFNRIAIIASDLLI
FT                   TPVSDKPFDLMGLQKYEEILKSLSVIQGETIKTHVLFNNINPAMKRFGELVDFICTSEH
FT                   FELMVSILRQRVDIAHSVGEGKSIKEYRIFSKADQEMDDLIVEVKSILNIK"
     MILTLSHQKG GVGKSTVAWN LAVYFSGIMD TRIVDLDTQR SLTVTNALRK EHNLPSIKMI        60
     HFNTAEELAE YAAADSDDVL TIIDSGGFDS AFNRIAIIAS DLLITPVSDK PFDLMGLQKY       120
     EEILKSLSVI QGETIKTHVL FNNINPAMKR FGELVDFICT SEHFELMVSI LRQRVDIAHS       180
     VGEGKSIKEY RIFSKADQEM DDLIVEVKSI LNIK                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page