(data stored in ACNUC7421 zone)

EMBL: CP002355.PE355

CP002355.PE355       Location/Qualifiers
FT   CDS             complement(351862..352392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_0519 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33023"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ24"
FT                   /protein_id="ADR33023.1"
FT                   /translation="MNKIVLILLIPLLLYGTTYDATLLQIGAKIFPKVALMEKGTKERI
FT                   QSTVNFVIVASPSNKAAAQRLSEIIEHQYNGILADHPLALFVVSPKEALEIKNAHSFVL
FT                   LMDPDDSILPMVLEHAAKTKTLTFSFDPLLLQKGAAVSLYIGRSVKPYINLATLKQVPF
FT                   TFEYGFLKLSQPY"
     MNKIVLILLI PLLLYGTTYD ATLLQIGAKI FPKVALMEKG TKERIQSTVN FVIVASPSNK        60
     AAAQRLSEII EHQYNGILAD HPLALFVVSP KEALEIKNAH SFVLLMDPDD SILPMVLEHA       120
     AKTKTLTFSF DPLLLQKGAA VSLYIGRSVK PYINLATLKQ VPFTFEYGFL KLSQPY           176
//

If you have problems or comments...

PBIL Back to PBIL home page