(data stored in ACNUC7421 zone)

EMBL: CP002355.PE356

CP002355.PE356       Location/Qualifiers
FT   CDS             complement(352389..353819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0357"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG4191 Signal transduction histidine kinase
FT                   regulating C4-dicarboxylate transport system; InterPro
FT                   IPR003594: IPR004358: IPR005467; KEGG: abu:Abu_0455
FT                   two-component sensor histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; SPTR: PAS/PAC sensor signal
FT                   transduction histidine kinase; PFAM: Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33024"
FT                   /db_xref="GOA:E4TZ25"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ25"
FT                   /protein_id="ADR33024.1"
FT                   /translation="MTQTLIGKFAWVFWLLYIAVIAPIYIFVQVNVSSVLNESEKAKIE
FT                   LIIQTLKPIISTYLTFDQTDMLNDTMRTFFQNPNIKDVSLVDVNQNIIFERHYPHSNIH
FT                   KTITLTTPVIDSITHQTQATLIISYSNNFVHDLQYKLFTQLIVLSLFALLIFTITYIYF
FT                   RKQFFVLRLLANWMGDYSIHKASEPFKSDNNNTEILTITSSANKMVETIEDYRVQMEEI
FT                   NNELEMRVENEIIQRREKEQLLIHQSRLAAMGEMIESIAHQWRQPLNIIGLAVADMNMK
FT                   RALGSLGEQELEKNTAIIDNNLQFMSNTIDDFRNFFNMDKESLNFSPVQPIHEIFSLLD
FT                   EQLRYANITYLIHENCNQEIFGVVNEFKQVILNIINNAQDAIKSRKNQIGGKIEITLRC
FT                   DINYLYIDISDTGGGVPIKIVERIFEPYFTTKLHNKGTGIGLYMSKVIIEQHFEGSLSV
FT                   SNTDDGALFTITMPLKHT"
     MTQTLIGKFA WVFWLLYIAV IAPIYIFVQV NVSSVLNESE KAKIELIIQT LKPIISTYLT        60
     FDQTDMLNDT MRTFFQNPNI KDVSLVDVNQ NIIFERHYPH SNIHKTITLT TPVIDSITHQ       120
     TQATLIISYS NNFVHDLQYK LFTQLIVLSL FALLIFTITY IYFRKQFFVL RLLANWMGDY       180
     SIHKASEPFK SDNNNTEILT ITSSANKMVE TIEDYRVQME EINNELEMRV ENEIIQRREK       240
     EQLLIHQSRL AAMGEMIESI AHQWRQPLNI IGLAVADMNM KRALGSLGEQ ELEKNTAIID       300
     NNLQFMSNTI DDFRNFFNMD KESLNFSPVQ PIHEIFSLLD EQLRYANITY LIHENCNQEI       360
     FGVVNEFKQV ILNIINNAQD AIKSRKNQIG GKIEITLRCD INYLYIDISD TGGGVPIKIV       420
     ERIFEPYFTT KLHNKGTGIG LYMSKVIIEQ HFEGSLSVSN TDDGALFTIT MPLKHT           476
//

If you have problems or comments...

PBIL Back to PBIL home page