(data stored in ACNUC7421 zone)

EMBL: CP002355.PE357

CP002355.PE357       Location/Qualifiers
FT   CDS             complement(353962..356094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0358"
FT                   /product="TonB-dependent receptor"
FT                   /note="COGs: COG4206 Outer membrane cobalamin receptor
FT                   protein; InterPro IPR012910: IPR000531: IPR006162; KEGG:
FT                   alv:Alvin_0601 TonB-dependent receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   SPTR: TonB-dependent receptor; PFAM: TonB-dependent
FT                   Receptor Plug Domain; TonB dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33025"
FT                   /db_xref="GOA:E4TZ26"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ26"
FT                   /protein_id="ADR33025.1"
FT                   /translation="MNITLILILFQYGAKLKHLSVFCISLLFSHSLLLAESSDDLDKVL
FT                   EEATTIATKTKLNADYVPGTVTVISSEKLKSLGITNLAEQNAFDMIVGFDSSTLSLRGS
FT                   GSIYGAEGNKIKWMINDKPISAEIWGIPKLGVGQIVFPIPTDAIDRIEIIRGPGSAIYG
FT                   GNAIYGVVNIITKKETGTLFTTLSQMQSNKFGKALGGYTSFRQNDLEASAIISAEKSDG
FT                   WDLPITTQAPAGSGNLPNAYGNSLIMADVSYKNFDFWAYKLKAKNDYARLQWDPSNFLP
FT                   QDNTEPVQSNTYTMLGVQGKFEITSNLLLTAKAGINQYENNADVMFFPSYLLGSNPSNL
FT                   DGVRKIDYRESTKYLEGMVETTIGSNRLLGGAYAGFLSVDQDDVTQMWSRVSGRTVYNP
FT                   SGTSTHLLTTNNPKRINRALYLQDEIQLDEQSTVTVGARYDTYSDGREALSPRIALVYQ
FT                   YDESNILKAQYSRAFRPPSFSEQYSPNNQASHTDYESETTDTIELSYIFKTKGSSLKTT
FT                   VFNTRTANMITYHDFTYETINLESPTTVNGLEIELSQNYESLALGANLSFYKSRRGDVE
FT                   LTRAGSTLNYDSSEFALSAKFIGNLFATLNSDTPYPTTVWYHYTGNKHRVNNETLDENG
FT                   NVKGIYTTNGSTPVQDYVNITQKINGIAKDLDLEFGVKNLFGKTLKTLYFPLNPPNTSD
FT                   IPYMKQTFWVNLLYRF"
     MNITLILILF QYGAKLKHLS VFCISLLFSH SLLLAESSDD LDKVLEEATT IATKTKLNAD        60
     YVPGTVTVIS SEKLKSLGIT NLAEQNAFDM IVGFDSSTLS LRGSGSIYGA EGNKIKWMIN       120
     DKPISAEIWG IPKLGVGQIV FPIPTDAIDR IEIIRGPGSA IYGGNAIYGV VNIITKKETG       180
     TLFTTLSQMQ SNKFGKALGG YTSFRQNDLE ASAIISAEKS DGWDLPITTQ APAGSGNLPN       240
     AYGNSLIMAD VSYKNFDFWA YKLKAKNDYA RLQWDPSNFL PQDNTEPVQS NTYTMLGVQG       300
     KFEITSNLLL TAKAGINQYE NNADVMFFPS YLLGSNPSNL DGVRKIDYRE STKYLEGMVE       360
     TTIGSNRLLG GAYAGFLSVD QDDVTQMWSR VSGRTVYNPS GTSTHLLTTN NPKRINRALY       420
     LQDEIQLDEQ STVTVGARYD TYSDGREALS PRIALVYQYD ESNILKAQYS RAFRPPSFSE       480
     QYSPNNQASH TDYESETTDT IELSYIFKTK GSSLKTTVFN TRTANMITYH DFTYETINLE       540
     SPTTVNGLEI ELSQNYESLA LGANLSFYKS RRGDVELTRA GSTLNYDSSE FALSAKFIGN       600
     LFATLNSDTP YPTTVWYHYT GNKHRVNNET LDENGNVKGI YTTNGSTPVQ DYVNITQKIN       660
     GIAKDLDLEF GVKNLFGKTL KTLYFPLNPP NTSDIPYMKQ TFWVNLLYRF                  710
//

If you have problems or comments...

PBIL Back to PBIL home page