(data stored in ACNUC7421 zone)

EMBL: CP002355.PE358

CP002355.PE358       Location/Qualifiers
FT   CDS             complement(356324..356647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0359"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfh:PFHG_02386 hypothetical protein; SPTR:
FT                   Binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33026"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ27"
FT                   /protein_id="ADR33026.1"
FT                   /translation="MNTRGTSIRQVALMSFGSDEVEAMESLNTLWVQTMDLKHENALVY
FT                   PLDIMVEHIGELYPLKYIDKDNFSTYEAENGSEWLISKSLHINDIDAFFKVYLHLSDEE
FT                   AAA"
     MNTRGTSIRQ VALMSFGSDE VEAMESLNTL WVQTMDLKHE NALVYPLDIM VEHIGELYPL        60
     KYIDKDNFST YEAENGSEWL ISKSLHINDI DAFFKVYLHL SDEEAAA                     107
//

If you have problems or comments...

PBIL Back to PBIL home page