(data stored in ACNUC7421 zone)

EMBL: CP002355.PE36

CP002355.PE36        Location/Qualifiers
FT   CDS             complement(36087..37664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0036"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004089: IPR003660: IPR004010; KEGG:
FT                   nis:NIS_1120 hypothetical protein; PFAM: chemotaxis sensory
FT                   transducer; histidine kinase HAMP region domain protein;
FT                   Cache domain protein; SMART: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Cache domain; HAMP domain;
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32704"
FT                   /db_xref="GOA:E4TW88"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW88"
FT                   /protein_id="ADR32704.1"
FT                   /translation="MNIFNTIKSKFIVNLVAAVGAILVSVIVAYFIAVGSIKEIMISDL
FT                   NTVADVLEKNVNYIANIEPKAYEETEFKEEIKKIKIGKSGYVYFINAEGVMTIHPKPED
FT                   EGKNKSGHDYVDHIRADKAGGIYEYVSATTGQDKIAAYRYIPAWDMWVIPGINKADYFE
FT                   ELRAGFFKWFLLLGTILTAMLIAINYVSGTSILHPIEELDKVSSDLAHGNGDLTKRLPI
FT                   LNKNDEIGIASLYLNQFITKIQSTINDTKQITSSAVDSTSTLNSAAANLSAQSEKTNTI
FT                   AQNTNKTASEIEVTLEQSVNMAKATLENSRLTETELSHVRDIATAITSEVHKTTQMSSE
FT                   LGERFAQLSSDAASVSGVLSIISDIADQTNLLALNAAIEAARAGEHGRGFAVVADEVRK
FT                   LAERTQKSLTEINSTISIVIQSISDSSDMMHSNSQNISRLAERSEEIDLKIDAASSALR
FT                   SNVDASHQSVQQSENMAQKIHEIIHKVSEMSSLSQSNQEEIKQISNIAVELYNAATNLN
FT                   TQLGQFKS"
     MNIFNTIKSK FIVNLVAAVG AILVSVIVAY FIAVGSIKEI MISDLNTVAD VLEKNVNYIA        60
     NIEPKAYEET EFKEEIKKIK IGKSGYVYFI NAEGVMTIHP KPEDEGKNKS GHDYVDHIRA       120
     DKAGGIYEYV SATTGQDKIA AYRYIPAWDM WVIPGINKAD YFEELRAGFF KWFLLLGTIL       180
     TAMLIAINYV SGTSILHPIE ELDKVSSDLA HGNGDLTKRL PILNKNDEIG IASLYLNQFI       240
     TKIQSTINDT KQITSSAVDS TSTLNSAAAN LSAQSEKTNT IAQNTNKTAS EIEVTLEQSV       300
     NMAKATLENS RLTETELSHV RDIATAITSE VHKTTQMSSE LGERFAQLSS DAASVSGVLS       360
     IISDIADQTN LLALNAAIEA ARAGEHGRGF AVVADEVRKL AERTQKSLTE INSTISIVIQ       420
     SISDSSDMMH SNSQNISRLA ERSEEIDLKI DAASSALRSN VDASHQSVQQ SENMAQKIHE       480
     IIHKVSEMSS LSQSNQEEIK QISNIAVELY NAATNLNTQL GQFKS                       525
//

If you have problems or comments...

PBIL Back to PBIL home page