(data stored in ACNUC7421 zone)

EMBL: CP002355.PE361

CP002355.PE361       Location/Qualifiers
FT   CDS             359328..360803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0362"
FT                   /product="phosphoglycerate mutase"
FT                   /note="COGs: COG0696 Phosphoglyceromutase; InterPro
FT                   IPR005995: IPR011258: IPR006124; KEGG: tdn:Suden_1614
FT                   phosphoglyceromutase; PFAM: BPG-independent PGAM domain
FT                   protein; metalloenzyme domain protein; PRIAM:
FT                   Phosphoglycerate mutase; SPTR:
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; TIGRFAM: phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: Metalloenzyme
FT                   superfamily; BPG-independent PGAM N-terminus (iPGM_N);
FT                   TIGRFAM: 2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33029"
FT                   /db_xref="GOA:E4TZ30"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ30"
FT                   /protein_id="ADR33029.1"
FT                   /translation="MSKKTVLVITDGIGYSPKHDFNAFHAAKKPTYDRLFSEVPHSLID
FT                   TFGLSVGLPEGQMGNSEVGHMSIGSGRVLYQDLVKISLALEEGTFEHNEVFTSLLKTSK
FT                   RLHLIALMSDGGVHSHIDHLIGVSEIAADMGKEVWLHLITDGRDVAPTSAKLFLNTIEA
FT                   HGSANIKIGSLGGRFFAMDRDNRWDRVQKGYEAIMSALPQSEQSVADYIENAYASGETD
FT                   EFITPTSFYGYEGVKEGDAVLMLNFRSDRMRELTTAIGDPEFNGFKRVFVPTHLATVTQ
FT                   YDKSFPYPVLFPKDAPVNTLAEVISKAGLRQLHTAETEKYAHVTFFFNGGIEEPYENET
FT                   RVLIPSPQVKTYDMQPQMSAPEVGSAVVKAMDEGIDFVVVNFANGDMVGHTGNFEAAIS
FT                   AVEAVDHELGRIVEAAQKNGYSMVLTSDHGNCEEMRDDAGNILTNHTVGKVWCFVMAEG
FT                   VSEVHPGALNNVAPTVLKLMELDIPSEMDTPLI"
     MSKKTVLVIT DGIGYSPKHD FNAFHAAKKP TYDRLFSEVP HSLIDTFGLS VGLPEGQMGN        60
     SEVGHMSIGS GRVLYQDLVK ISLALEEGTF EHNEVFTSLL KTSKRLHLIA LMSDGGVHSH       120
     IDHLIGVSEI AADMGKEVWL HLITDGRDVA PTSAKLFLNT IEAHGSANIK IGSLGGRFFA       180
     MDRDNRWDRV QKGYEAIMSA LPQSEQSVAD YIENAYASGE TDEFITPTSF YGYEGVKEGD       240
     AVLMLNFRSD RMRELTTAIG DPEFNGFKRV FVPTHLATVT QYDKSFPYPV LFPKDAPVNT       300
     LAEVISKAGL RQLHTAETEK YAHVTFFFNG GIEEPYENET RVLIPSPQVK TYDMQPQMSA       360
     PEVGSAVVKA MDEGIDFVVV NFANGDMVGH TGNFEAAISA VEAVDHELGR IVEAAQKNGY       420
     SMVLTSDHGN CEEMRDDAGN ILTNHTVGKV WCFVMAEGVS EVHPGALNNV APTVLKLMEL       480
     DIPSEMDTPL I                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page