(data stored in ACNUC7421 zone)

EMBL: CP002355.PE362

CP002355.PE362       Location/Qualifiers
FT   CDS             360874..361617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0363"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR011284: IPR002198: IPR002347:
FT                   IPR020904; KEGG: tdn:Suden_1613
FT                   3-ketoacyl-(acyl-carrier-protein) reductase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; SPTR:
FT                   3-oxoacyl-[acyl-carrier-protein] reductase; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) reductase; PFAM: short
FT                   chain dehydrogenase; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33030"
FT                   /db_xref="GOA:E4TZ31"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ31"
FT                   /protein_id="ADR33030.1"
FT                   /translation="MKFSGKNVLVTGSSRGIGAEVAKVLALYGLKVWINYRSGAAAADA
FT                   VKAQIEAAGGQAAVIGFDVADEAAFVDAIKTIIDADGELSYLVNNAGITKDALALRMKS
FT                   DDFMAVINANLLSAFVGCREAFKAMRKQKFGAIVNIASIVGETGNAGQTNYAASKGGVI
FT                   AMTKSFAQEAASSGIRYNTVTPGFIATDMTDVLSEEIKASFTSKIPMGRFGNAAEVAEA
FT                   TAFLLSDHSSYITGETLKVNGGMFM"
     MKFSGKNVLV TGSSRGIGAE VAKVLALYGL KVWINYRSGA AAADAVKAQI EAAGGQAAVI        60
     GFDVADEAAF VDAIKTIIDA DGELSYLVNN AGITKDALAL RMKSDDFMAV INANLLSAFV       120
     GCREAFKAMR KQKFGAIVNI ASIVGETGNA GQTNYAASKG GVIAMTKSFA QEAASSGIRY       180
     NTVTPGFIAT DMTDVLSEEI KASFTSKIPM GRFGNAAEVA EATAFLLSDH SSYITGETLK       240
     VNGGMFM                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page