(data stored in ACNUC7421 zone)

EMBL: CP002355.PE363

CP002355.PE363       Location/Qualifiers
FT   CDS             361699..361929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0364"
FT                   /product="acyl carrier protein"
FT                   /note="InterPro IPR003231: IPR006163: IPR006162: IPR009081;
FT                   KEGG: tdn:Suden_1610 acyl carrier protein (ACP); PFAM:
FT                   phosphopantetheine-binding; SPTR: Acyl carrier protein;
FT                   TIGRFAM: acyl carrier protein; PFAM: Phosphopantetheine
FT                   attachment site; TIGRFAM: acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33031"
FT                   /db_xref="GOA:E4TZ32"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ32"
FT                   /protein_id="ADR33031.1"
FT                   /translation="MALLEDIKEVVVEQLSVNPDEVKENSKFVEDLGADSLDVVELVMA
FT                   LEEKFDIEIPDDEAEKIQTVQDVINYIESKN"
     MALLEDIKEV VVEQLSVNPD EVKENSKFVE DLGADSLDVV ELVMALEEKF DIEIPDDEAE        60
     KIQTVQDVIN YIESKN                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page