(data stored in ACNUC7421 zone)

EMBL: CP002355.PE364

CP002355.PE364       Location/Qualifiers
FT   CDS             362041..363258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0365"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="COGs: COG0304 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase; InterProIPR017568: IPR014030: IPR014031:
FT                   IPR017441: IPR 018201; KEGG: tdn:Suden_1609 3-oxoacyl-(acyl
FT                   carrier protein) synthase II; PFAM: Beta-ketoacyl synthase;
FT                   SPTR: 3-oxoacyl-(Acyl-carrier-protein) synthase 2; TIGRFAM:
FT                   3-oxoacyl-[acyl-carrier-protein] synthase 2; PFAM:
FT                   Beta-ketoacyl synthase, N-terminal domain; Beta-ketoacyl
FT                   synthase, C-terminal domain; TIGRFAM:
FT                   beta-ketoacyl-acyl-carrier-protein synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33032"
FT                   /db_xref="GOA:E4TZ33"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ33"
FT                   /protein_id="ADR33032.1"
FT                   /translation="MRRVVVTGMGMINALGHDKESSFKAICDGECGIDMITIFDASTQS
FT                   AQIAGEVKNFDPETVMDAREVKKADRFIHLGIKAAQEAMADANFPEGFDKERFGIDAAA
FT                   GIGGLPSIEKNSIILETKGARRISPFFIPGALVNMLGGFISIDHGLQGPNLSAVTACAA
FT                   GTHAISEAAKTIMVGGADQMLVVAAESAITGVGIGGFASMKALSTRNDDPKHASRPFDA
FT                   DRDGFVMGEGAAALVLEEYDAAVARGARIYAEVIGFGESGDANHITTPSLEGPLRAMKA
FT                   ALKMAGNPKVDYVNAHGTSTPTNDKNETAALKIAFGSKENCPPVSSTKGQTGHCLGAAG
FT                   GIEAVISIMAMRDGIIPPTINYVNPDENCDLDIVPNTARKAELNIVMSNSFGFGGTNGV
FT                   VIFKKI"
     MRRVVVTGMG MINALGHDKE SSFKAICDGE CGIDMITIFD ASTQSAQIAG EVKNFDPETV        60
     MDAREVKKAD RFIHLGIKAA QEAMADANFP EGFDKERFGI DAAAGIGGLP SIEKNSIILE       120
     TKGARRISPF FIPGALVNML GGFISIDHGL QGPNLSAVTA CAAGTHAISE AAKTIMVGGA       180
     DQMLVVAAES AITGVGIGGF ASMKALSTRN DDPKHASRPF DADRDGFVMG EGAAALVLEE       240
     YDAAVARGAR IYAEVIGFGE SGDANHITTP SLEGPLRAMK AALKMAGNPK VDYVNAHGTS       300
     TPTNDKNETA ALKIAFGSKE NCPPVSSTKG QTGHCLGAAG GIEAVISIMA MRDGIIPPTI       360
     NYVNPDENCD LDIVPNTARK AELNIVMSNS FGFGGTNGVV IFKKI                       405
//

If you have problems or comments...

PBIL Back to PBIL home page