(data stored in ACNUC7421 zone)

EMBL: CP002355.PE365

CP002355.PE365       Location/Qualifiers
FT   CDS             363271..364206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0366"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /EC_number="6.4.1.2"
FT                   /note="COGs: COG0825 Acetyl-CoA carboxylase alpha subunit;
FT                   InterPro IPR001095: IPR020582: IPR011763; KEGG:
FT                   tdn:Suden_1608 acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha; PFAM: Acetyl-CoA carboxylase, alpha subunit,
FT                   conserved region; PRIAM: Acetyl-CoA carboxylase; SPTR:
FT                   Acetyl-coenzyme A carboxylase carboxyl transferase subunit
FT                   alpha; TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, alpha subunit; PFAM: Acetyl co-enzyme A
FT                   carboxylase carboxyltransferase alpha subunit; TIGRFAM:
FT                   acetyl-CoA carboxylase, carboxyl transferase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33033"
FT                   /db_xref="GOA:E4TZ34"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ34"
FT                   /protein_id="ADR33033.1"
FT                   /translation="MATYLDFEQNIRQIQEEIIAAEVRYDHHAVEILKQDLDKEVQKTY
FT                   ANLSPYQELQLARHQDRPYALDYINLILDKKYEIHGDRHFRDDLSIICYIGTIGDERVM
FT                   VIGEQKGRGTKNKLKRNFGMPHPEGYRKALRAAKMAEKFNIPLLMLIDTPGAYPGLGAE
FT                   ERNQSEAIARNLLELSNLNTITVSVVIGEGGSGGALAIGVADRLAMMRYSVFSVISPEG
FT                   CSAILWNDPTKVEAATKALKITSADLKELDLIDDIIDEPLIGAHRDKEGSANALKSYFM
FT                   TQVNTLRKLSDSERLDKRYNRLVGMGRFSE"
     MATYLDFEQN IRQIQEEIIA AEVRYDHHAV EILKQDLDKE VQKTYANLSP YQELQLARHQ        60
     DRPYALDYIN LILDKKYEIH GDRHFRDDLS IICYIGTIGD ERVMVIGEQK GRGTKNKLKR       120
     NFGMPHPEGY RKALRAAKMA EKFNIPLLML IDTPGAYPGL GAEERNQSEA IARNLLELSN       180
     LNTITVSVVI GEGGSGGALA IGVADRLAMM RYSVFSVISP EGCSAILWND PTKVEAATKA       240
     LKITSADLKE LDLIDDIIDE PLIGAHRDKE GSANALKSYF MTQVNTLRKL SDSERLDKRY       300
     NRLVGMGRFS E                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page