(data stored in ACNUC7421 zone)

EMBL: CP002355.PE366

CP002355.PE366       Location/Qualifiers
FT   CDS             complement(364247..365050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0367"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="COGs: COG2176 DNA polymerase III alpha subunit
FT                   (gram-positive type); InterPro IPR013520: IPR006055; KEGG:
FT                   tdn:Suden_1607 DNA polymerase III subunit epsilon; PFAM:
FT                   Exonuclease RNase T and DNA polymerase III; SMART:
FT                   Exonuclease; SPTR: Exonuclease; PFAM: Exonuclease; TIGRFAM:
FT                   exonuclease, DNA polymerase III, epsilon subunit family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33034"
FT                   /db_xref="GOA:E4TZ35"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ35"
FT                   /protein_id="ADR33034.1"
FT                   /translation="MKLFDPKILSRLSKNGIPKEEFELLLGSDADLRLELLKSQGMNII
FT                   LHEEMYCFQSAITSVKDTLFCIVDVESNGSKPAHHQIIEIGAVKLQNGKIIDTYESLVY
FT                   CTDISDQIQEITGIKTEQTLKAPAMSKVMREFRLFLGDAIFVGHDAKFDYNFVSAMMER
FT                   VGLSKLLNRSLCTIDLAERTIESERYGLAYLNTALELYKEATHHRALSDAMTTTKLLKR
FT                   VLNLLPSSITNSEELIAFSKEAKRLKRPKPKKEEKKETEEKEAVK"
     MKLFDPKILS RLSKNGIPKE EFELLLGSDA DLRLELLKSQ GMNIILHEEM YCFQSAITSV        60
     KDTLFCIVDV ESNGSKPAHH QIIEIGAVKL QNGKIIDTYE SLVYCTDISD QIQEITGIKT       120
     EQTLKAPAMS KVMREFRLFL GDAIFVGHDA KFDYNFVSAM MERVGLSKLL NRSLCTIDLA       180
     ERTIESERYG LAYLNTALEL YKEATHHRAL SDAMTTTKLL KRVLNLLPSS ITNSEELIAF       240
     SKEAKRLKRP KPKKEEKKET EEKEAVK                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page