(data stored in ACNUC7421 zone)

EMBL: CP002355.PE37

CP002355.PE37        Location/Qualifiers
FT   CDS             37733..39061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0037"
FT                   /product="Fibronectin-binding A domain protein"
FT                   /note="COGs: COG1293 RNA-binding protein homologous to
FT                   eukaryotic snRNP; InterPro IPR008616: IPR008532; KEGG:
FT                   tdn:Suden_0123 hypothetical protein; PFAM:
FT                   Fibronectin-binding A domain protein; protein of unknown
FT                   function DUF814; SPTR: Putative uncharacterized protein;
FT                   PFAM: Domain of unknown function (DUF814);
FT                   Fibronectin-binding protein A N-terminus (FbpA)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32705"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW89"
FT                   /protein_id="ADR32705.1"
FT                   /translation="MRFSYLKQIVAYMQQEFSYVVAAYRVNDTTLKLVFNRENSWNFEM
FT                   QRGNSAITIGEIPNRGKMYQAPFDILIAKRLNRSTIQSITLHNNDKIIRITTTTSGSYK
FT                   SETTILQLEFTGKHTNVILLDKEGIVLEALRHIDEDVSARSVRVGQKLGEIPSPPFEPK
FT                   EYPLENVRDYLIEEFRRRNSDKLNQLKHEKKALLQKRLGQLHKHLDALEEEGVLIQDAQ
FT                   ASQNAGHLILANLDVVKPYGKKAELINFDGTPVELELPSGCTTAAGCAESFFKRSKKAK
FT                   QKAQGLHQERSNLEAKIRHLELFIQTVEEATSPEEITLLFPPKAMGSKVKSSDSIAEFW
FT                   IEGVKVSLGKSEKGNIELLRNAKARDIWMHLKDRPSAHVIISTDKQQLPEKLLEAAAKL
FT                   CVDFSVFEKGRYLVDYTPRREVKMGEGANVLYTDYKTLNIEKG"
     MRFSYLKQIV AYMQQEFSYV VAAYRVNDTT LKLVFNRENS WNFEMQRGNS AITIGEIPNR        60
     GKMYQAPFDI LIAKRLNRST IQSITLHNND KIIRITTTTS GSYKSETTIL QLEFTGKHTN       120
     VILLDKEGIV LEALRHIDED VSARSVRVGQ KLGEIPSPPF EPKEYPLENV RDYLIEEFRR       180
     RNSDKLNQLK HEKKALLQKR LGQLHKHLDA LEEEGVLIQD AQASQNAGHL ILANLDVVKP       240
     YGKKAELINF DGTPVELELP SGCTTAAGCA ESFFKRSKKA KQKAQGLHQE RSNLEAKIRH       300
     LELFIQTVEE ATSPEEITLL FPPKAMGSKV KSSDSIAEFW IEGVKVSLGK SEKGNIELLR       360
     NAKARDIWMH LKDRPSAHVI ISTDKQQLPE KLLEAAAKLC VDFSVFEKGR YLVDYTPRRE       420
     VKMGEGANVL YTDYKTLNIE KG                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page