(data stored in ACNUC7421 zone)

EMBL: CP002355.PE370

CP002355.PE370       Location/Qualifiers
FT   CDS             complement(367717..368526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0371"
FT                   /product="putative signal transduction protein"
FT                   /note="KEGG: tdn:Suden_1603 putative signal transduction
FT                   protein; SPTR: Putative signal transduction protein; PFAM:
FT                   HDOD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33038"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ39"
FT                   /protein_id="ADR33038.1"
FT                   /translation="MVTQEQITSYIQNIPPAPFVVKQTLDYVRVGDLTKAAKCAEEDPA
FT                   LKFYLKTLVNRPIYGFRNEVSDLAQIFTILGISTAQQILYNYLLSLLAPKEWGLFKLTS
FT                   QEFYDLQASLSRKWVKILTHLNLHNHDTESAITLLPASIIVCDALFGEYKSEVAQLRSV
FT                   KALDYNTILYRLTKMSLFNICTEIGEKWELSPMISRIVHASSGLDQNLEENEKTLAKWM
FT                   HLLLFYELSQNAYVEAGLNEFIEFQIEFVQDIYESFMQVVEYDESDR"
     MVTQEQITSY IQNIPPAPFV VKQTLDYVRV GDLTKAAKCA EEDPALKFYL KTLVNRPIYG        60
     FRNEVSDLAQ IFTILGISTA QQILYNYLLS LLAPKEWGLF KLTSQEFYDL QASLSRKWVK       120
     ILTHLNLHNH DTESAITLLP ASIIVCDALF GEYKSEVAQL RSVKALDYNT ILYRLTKMSL       180
     FNICTEIGEK WELSPMISRI VHASSGLDQN LEENEKTLAK WMHLLLFYEL SQNAYVEAGL       240
     NEFIEFQIEF VQDIYESFMQ VVEYDESDR                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page