(data stored in ACNUC7421 zone)

EMBL: CP002355.PE372

CP002355.PE372       Location/Qualifiers
FT   CDS             369030..370217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0373"
FT                   /product="N-acetylglutamate synthase; glutamate
FT                   N-acetyltransferase"
FT                   /EC_number="2.3.1.35"
FT                   /EC_number="2.3.1.1"
FT                   /note="COGs: COG1364 N-acetylglutamate synthase
FT                   (N-acetylornithine aminotransferase); InterPro IPR002813;
FT                   KEGG: tdn:Suden_1600 bifunctional ornithine
FT                   acetyltransferase/N-acetylglutamate synthase protein; PFAM:
FT                   arginine biosynthesis protein ArgJ; PRIAM: Amino-acid
FT                   N-acetyltransferase; SPTR: N-acetylglutamate synthase /
FT                   glutamate N-acetyltransferase; TIGRFAM: arginine
FT                   biosynthesis bifunctional protein ArgJ; PFAM: ArgJ family;
FT                   TIGRFAM: glutamate N-acetyltransferase/amino-acid
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33040"
FT                   /db_xref="GOA:E4TZ41"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ41"
FT                   /protein_id="ADR33040.1"
FT                   /translation="MAILNTIEGGVCAAKGFFADGIHIGLKKEGAKDLAFIYSEKPCAI
FT                   ASVFTTNKMTAAPIRHFRSLGEFEGNFVLINSKNANAMTGRAGIDDITEVLGELKSKFP
FT                   QIQNPVMSSTGVIGVRLPKAKIIEGAMKFDLTRREGINASEAIMTTDTFSKRLAYEVTL
FT                   ENGQSFRIGAMAKGAGMINPAMATMLCFITTDAAVDKTTMQDILDECVHTTFNAASVDG
FT                   DTSTNDTVVVMANGLSGAFHAGAFKEALESIMLFLAKEMVRDGEGATKLVTYKVTGAIN
FT                   HKEAEIAAKALSNSLLVKTALFGQDPNWGRIASTVGASGIMCDEAFLSIWFDDICVYKK
FT                   GELLFDEKLEPLAAAVMQKSSFTIHCDIGLQDGEFTAYGCDLGHEYVKINADYRT"
     MAILNTIEGG VCAAKGFFAD GIHIGLKKEG AKDLAFIYSE KPCAIASVFT TNKMTAAPIR        60
     HFRSLGEFEG NFVLINSKNA NAMTGRAGID DITEVLGELK SKFPQIQNPV MSSTGVIGVR       120
     LPKAKIIEGA MKFDLTRREG INASEAIMTT DTFSKRLAYE VTLENGQSFR IGAMAKGAGM       180
     INPAMATMLC FITTDAAVDK TTMQDILDEC VHTTFNAASV DGDTSTNDTV VVMANGLSGA       240
     FHAGAFKEAL ESIMLFLAKE MVRDGEGATK LVTYKVTGAI NHKEAEIAAK ALSNSLLVKT       300
     ALFGQDPNWG RIASTVGASG IMCDEAFLSI WFDDICVYKK GELLFDEKLE PLAAAVMQKS       360
     SFTIHCDIGL QDGEFTAYGC DLGHEYVKIN ADYRT                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page