(data stored in ACNUC7421 zone)

EMBL: CP002355.PE373

CP002355.PE373       Location/Qualifiers
FT   CDS             370403..371332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0374"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="COGs: COG0462 Phosphoribosylpyrophosphate
FT                   synthetase; InterPro IPR005946: IPR000836: IPR000842; KEGG:
FT                   tdn:Suden_1636 ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase; PRIAM: Ribose-phosphate
FT                   diphosphokinase; SPTR: Ribose-phosphate pyrophosphokinase;
FT                   TIGRFAM: ribose-phosphate pyrophosphokinase; PFAM:
FT                   Phosphoribosyl transferase domain; TIGRFAM:
FT                   ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33041"
FT                   /db_xref="GOA:E4TZ42"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ42"
FT                   /protein_id="ADR33041.1"
FT                   /translation="MRGYKIFSGSACTEFAAEVCRTLDVPLSKASVKRFSDGEINVQIS
FT                   ESVRGRDVFIIQSTGAPSNDNLMELLIMTDALRRSSANSITAVVPYFGYARQDRKAAPR
FT                   VPITAKLVADMFETAGIDRVVTIDLHAGQIQGFFDIPVDNLYGAIIFEEYIRSKNLANP
FT                   VIASPDIGGVARARYFAEKLGLEMVIVDKRREKANESEVMNIIGDVAGKDIIMIDDMVD
FT                   TAGTMVKAAAALKKRGATSVMACATHGVLSGKAYENLNNGELDELVISNTLVLSGQSDK
FT                   IKVLSVAPLFAEVIRRVYHNESVNSLFS"
     MRGYKIFSGS ACTEFAAEVC RTLDVPLSKA SVKRFSDGEI NVQISESVRG RDVFIIQSTG        60
     APSNDNLMEL LIMTDALRRS SANSITAVVP YFGYARQDRK AAPRVPITAK LVADMFETAG       120
     IDRVVTIDLH AGQIQGFFDI PVDNLYGAII FEEYIRSKNL ANPVIASPDI GGVARARYFA       180
     EKLGLEMVIV DKRREKANES EVMNIIGDVA GKDIIMIDDM VDTAGTMVKA AAALKKRGAT       240
     SVMACATHGV LSGKAYENLN NGELDELVIS NTLVLSGQSD KIKVLSVAPL FAEVIRRVYH       300
     NESVNSLFS                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page