(data stored in ACNUC7421 zone)

EMBL: CP002355.PE374

CP002355.PE374       Location/Qualifiers
FT   CDS             371417..373207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0375"
FT                   /product="GTP-binding protein LepA"
FT                   /note="COGs: COG0481 Membrane GTPase LepA;
FT                   InterProIPR005225: IPR006297: IPR000795: IPR004161: IPR
FT                   000640: IPR013842; KEGG: tdn:Suden_1637 GTP-binding protein
FT                   LepA; PFAM: GTP-binding protein LepA domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; elongation factor G domain-containing
FT                   protein; SPTR: GTP-binding protein lepA; TIGRFAM:
FT                   GTP-binding protein LepA; small GTP-binding protein; PFAM:
FT                   Elongation factor Tu domain 2; Elongation factor G
FT                   C-terminus; Elongation factor Tu GTP binding domain;
FT                   GTP-binding protein LepA C-terminus; TIGRFAM: GTP-binding
FT                   protein LepA; small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33042"
FT                   /db_xref="GOA:E4TZ43"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ43"
FT                   /protein_id="ADR33042.1"
FT                   /translation="MDNIRNFSIIAHIDHGKSTLADRIIQECGAVSDRELTKQMMDTMD
FT                   IEQERGITIKAQSVRLDYVKDGKHYILNLIDTPGHVDFSYEVSKSLASSDGALLIVDAA
FT                   QGVEAQTIANVYMAMENNLTLIPVINKIDLPAAEPERVAEEIETTIGIDATDAVMISAK
FT                   TGVGIRELIDAIVDRIPAPVGDPSATTKAIIYDSWFDSYQGAMALVRVFDGEIKTGQMV
FT                   KLMHNNENHQVLELLYPHPLRRQKTQSIKSGEIGIVILGVKEVGSIRVGDTITDARNPA
FT                   KEPVGEYAPAKPFVFAGIYPIDTDEFESVRDALDKLKLNDSSLSYEPETSIALGFGFRV
FT                   GFLGMLHMEVVKERLEREFNLDLIATAPSVVYKVYKTDGTMVEVQNPSELPEPQNIERI
FT                   EEPYVRATVIVPTDYLGNVITLLTAKRGMQEKMEYLNETRVMLIYVMPMNEIVVDFYDK
FT                   LKSTSKGYASFDYDPIEFRQGDLVKLDVRVAGDVVDALSVIVPRSSAESRGRALVTNMK
FT                   EIVPRQLFEVAIQASIGNRVIARETVKSMGKNVTAKCYGGDISRKRKLLDKQKEGKKRM
FT                   KAIGKVQLPQEAFMSVLKMD"
     MDNIRNFSII AHIDHGKSTL ADRIIQECGA VSDRELTKQM MDTMDIEQER GITIKAQSVR        60
     LDYVKDGKHY ILNLIDTPGH VDFSYEVSKS LASSDGALLI VDAAQGVEAQ TIANVYMAME       120
     NNLTLIPVIN KIDLPAAEPE RVAEEIETTI GIDATDAVMI SAKTGVGIRE LIDAIVDRIP       180
     APVGDPSATT KAIIYDSWFD SYQGAMALVR VFDGEIKTGQ MVKLMHNNEN HQVLELLYPH       240
     PLRRQKTQSI KSGEIGIVIL GVKEVGSIRV GDTITDARNP AKEPVGEYAP AKPFVFAGIY       300
     PIDTDEFESV RDALDKLKLN DSSLSYEPET SIALGFGFRV GFLGMLHMEV VKERLEREFN       360
     LDLIATAPSV VYKVYKTDGT MVEVQNPSEL PEPQNIERIE EPYVRATVIV PTDYLGNVIT       420
     LLTAKRGMQE KMEYLNETRV MLIYVMPMNE IVVDFYDKLK STSKGYASFD YDPIEFRQGD       480
     LVKLDVRVAG DVVDALSVIV PRSSAESRGR ALVTNMKEIV PRQLFEVAIQ ASIGNRVIAR       540
     ETVKSMGKNV TAKCYGGDIS RKRKLLDKQK EGKKRMKAIG KVQLPQEAFM SVLKMD           596
//

If you have problems or comments...

PBIL Back to PBIL home page