(data stored in ACNUC7421 zone)

EMBL: CP002355.PE376

CP002355.PE376       Location/Qualifiers
FT   CDS             complement(373785..375278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0377"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pin:Ping_2350 hypothetical protein; SPTR:
FT                   Nitroreductase; PFAM: Nitroreductase family; TIGRFAM:
FT                   SagB-type dehydrogenase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33044"
FT                   /db_xref="GOA:E4TZ45"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ45"
FT                   /protein_id="ADR33044.1"
FT                   /translation="MKNVSSVLEYHDRTKHRPSRYAASLGYMDWETQPNPFRRYENAPL
FT                   IPLPFSEATPPYHLLFQPDSLPYAPLCIESLAQLLRYALGLAAIKSHGGSEWALRCNAS
FT                   SGNLHPSECYIIAPPLKGLSDSPTLSHYAPRKHALELLHTYREPIGEETLLIALSSVIW
FT                   REAWKYGERCWRYCQLDAGHAAESIRISAAMLGWECSVLSIDTADIASLCGLDQLHRYD
FT                   PNERESPDMLLQIRKGSFTLPKTPELLYNANRLSHSHHLWPILEIIDTATQGEYPRPVI
FT                   MKESRHTPSPTKSSGEIVLKRRSAQMMDGLGITLEQFRQLLDASLFCRDASDVNLVIFV
FT                   HRVEGLEKGLYAYIRDLKELLSLQNSMDSTFEWAEFTEGLYRLRSGDYRGAAQMVSCNQ
FT                   EIAKDGAFSFGMLCNFSSSLERHGAIGYKNLFHQCGMIGQMLYLEATSLGLSATGIGCF
FT                   LDDEFHALLGLRDQKYQSLYHFTIGRAIVDTRITSRQPY"
     MKNVSSVLEY HDRTKHRPSR YAASLGYMDW ETQPNPFRRY ENAPLIPLPF SEATPPYHLL        60
     FQPDSLPYAP LCIESLAQLL RYALGLAAIK SHGGSEWALR CNASSGNLHP SECYIIAPPL       120
     KGLSDSPTLS HYAPRKHALE LLHTYREPIG EETLLIALSS VIWREAWKYG ERCWRYCQLD       180
     AGHAAESIRI SAAMLGWECS VLSIDTADIA SLCGLDQLHR YDPNERESPD MLLQIRKGSF       240
     TLPKTPELLY NANRLSHSHH LWPILEIIDT ATQGEYPRPV IMKESRHTPS PTKSSGEIVL       300
     KRRSAQMMDG LGITLEQFRQ LLDASLFCRD ASDVNLVIFV HRVEGLEKGL YAYIRDLKEL       360
     LSLQNSMDST FEWAEFTEGL YRLRSGDYRG AAQMVSCNQE IAKDGAFSFG MLCNFSSSLE       420
     RHGAIGYKNL FHQCGMIGQM LYLEATSLGL SATGIGCFLD DEFHALLGLR DQKYQSLYHF       480
     TIGRAIVDTR ITSRQPY                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page