(data stored in ACNUC7421 zone)

EMBL: CP002355.PE377

CP002355.PE377       Location/Qualifiers
FT   CDS             complement(375326..376573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0378"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1642 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33045"
FT                   /db_xref="GOA:E4TZ46"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ46"
FT                   /protein_id="ADR33045.1"
FT                   /translation="MKRIRYFHHTLIGKIFFSFLGVILAAAAVIFSPWGNRLTAPLIEK
FT                   SLTSAFSTPITLQEYGLTPNQFQLLFQDQYGNTFSTQGGFSLLTLRMYAHYRLSCFQHG
FT                   GINPLFSPFKTEGSLSGGIASLLIQGNGDMFGGDLIYKIELHRFHLASLNLKADKIAYT
FT                   PLMQLLKYPSDTDTLLTGGIDLRGFDQRYVEGSILLNSKTRRFNPTPIAKDNNESVTLK
FT                   SLLADKYGDVKPFNVKVTINTSLDHAGILEQFVGMPLGGALELNATLTGDQKLLRLKGN
FT                   SDVARSDTSISLTIADLEPSKLSFDCKHADLEQTFKLFALTPPISGSGDLYGELNTTGG
FT                   SVNVIITEASTVPKVLFQEYQITQPLIRFDAEVHADLSKKGVHYRGSFQSDLSRMETDN
FT                   TTTHEQMLRDLLKSLH"
     MKRIRYFHHT LIGKIFFSFL GVILAAAAVI FSPWGNRLTA PLIEKSLTSA FSTPITLQEY        60
     GLTPNQFQLL FQDQYGNTFS TQGGFSLLTL RMYAHYRLSC FQHGGINPLF SPFKTEGSLS       120
     GGIASLLIQG NGDMFGGDLI YKIELHRFHL ASLNLKADKI AYTPLMQLLK YPSDTDTLLT       180
     GGIDLRGFDQ RYVEGSILLN SKTRRFNPTP IAKDNNESVT LKSLLADKYG DVKPFNVKVT       240
     INTSLDHAGI LEQFVGMPLG GALELNATLT GDQKLLRLKG NSDVARSDTS ISLTIADLEP       300
     SKLSFDCKHA DLEQTFKLFA LTPPISGSGD LYGELNTTGG SVNVIITEAS TVPKVLFQEY       360
     QITQPLIRFD AEVHADLSKK GVHYRGSFQS DLSRMETDNT TTHEQMLRDL LKSLH            415
//

If you have problems or comments...

PBIL Back to PBIL home page