(data stored in ACNUC7421 zone)

EMBL: CP002355.PE379

CP002355.PE379       Location/Qualifiers
FT   CDS             378140..378679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0380"
FT                   /product="GrpE protein"
FT                   /note="COGs: COG0576 Molecular chaperone GrpE (heat shock
FT                   protein); InterPro IPR000740; KEGG: tdn:Suden_1643 GrpE
FT                   protein; PFAM: GrpE protein; SPTR: Protein grpE; PFAM:
FT                   GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33047"
FT                   /db_xref="GOA:E4TZ48"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ48"
FT                   /protein_id="ADR33047.1"
FT                   /translation="MSNEVNEDVISDEQTSQNTGEEVIAESMNELETIQAELASFKDKY
FT                   ARVHADFDNIKKRLEREKYQALEYANEKFAKDLIPVVDSLGMAIGAAEIEAEPAVLLEK
FT                   LKEGVELTMKQLLGVLEKHGVTPVDESEPFDPNIHNAVQRVDSPDHESGAIVNTFQKGF
FT                   RYKERTLRDAMVVIAN"
     MSNEVNEDVI SDEQTSQNTG EEVIAESMNE LETIQAELAS FKDKYARVHA DFDNIKKRLE        60
     REKYQALEYA NEKFAKDLIP VVDSLGMAIG AAEIEAEPAV LLEKLKEGVE LTMKQLLGVL       120
     EKHGVTPVDE SEPFDPNIHN AVQRVDSPDH ESGAIVNTFQ KGFRYKERTL RDAMVVIAN        179
//

If you have problems or comments...

PBIL Back to PBIL home page