(data stored in ACNUC7421 zone)

EMBL: CP002355.PE38

CP002355.PE38        Location/Qualifiers
FT   CDS             39073..39381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0124 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32706"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW90"
FT                   /protein_id="ADR32706.1"
FT                   /translation="MADIGPIGGAIYVNQQMASVASEKNAVLNRFELQALAAASASQEA
FT                   KKEIEEVRPTEENQGVDPDREHTKEQAEQEERRSEHNEKNEENEKPLKPLHLLDIKV"
     MADIGPIGGA IYVNQQMASV ASEKNAVLNR FELQALAAAS ASQEAKKEIE EVRPTEENQG        60
     VDPDREHTKE QAEQEERRSE HNEKNEENEK PLKPLHLLDI KV                          102
//

If you have problems or comments...

PBIL Back to PBIL home page