(data stored in ACNUC7421 zone)

EMBL: CP002355.PE381

CP002355.PE381       Location/Qualifiers
FT   CDS             380783..381079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0382"
FT                   /product="plasmid maintenance system killer"
FT                   /note="COGs: COG3549 Plasmid maintenance system killer
FT                   protein; InterPro IPR007711; KEGG: cja:CJA_3612 plasmid
FT                   maintenance system killer protein; PFAM: plasmid
FT                   maintenance system killer; SPTR: Plasmid maintenance system
FT                   killer protein; PFAM: Plasmid maintenance system killer
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33049"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ50"
FT                   /protein_id="ADR33049.1"
FT                   /translation="MIISFADQATSDIFNGIESKQARKALPMELWKSASRKLDQIDSVI
FT                   MLDELKVPPGNRLEKLRGSRENQMSIRINDQYRICFTWSDTGAVNVEITDYHS"
     MIISFADQAT SDIFNGIESK QARKALPMEL WKSASRKLDQ IDSVIMLDEL KVPPGNRLEK        60
     LRGSRENQMS IRINDQYRIC FTWSDTGAVN VEITDYHS                                98
//

If you have problems or comments...

PBIL Back to PBIL home page