(data stored in ACNUC7421 zone)

EMBL: CP002355.PE382

CP002355.PE382       Location/Qualifiers
FT   CDS             381090..381389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0383"
FT                   /product="plasmid maintenance system antidote protein, XRE
FT                   family"
FT                   /note="COGs: COG3093 Plasmid maintenance system antidote
FT                   protein; InterPro IPR013430: IPR001387; KEGG: pph:Ppha_2031
FT                   XRE family plasmid maintenance system antidote protein;
FT                   PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; SPTR: Plasmid maintenance
FT                   system antidote protein, XRE family; TIGRFAM: addiction
FT                   module antidote protein, HigA family; PFAM:
FT                   Helix-turn-helix; TIGRFAM: addiction module antidote
FT                   protein, HigA family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33050"
FT                   /db_xref="GOA:E4TZ51"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ51"
FT                   /protein_id="ADR33050.1"
FT                   /translation="MNIPTHRAPTHPGEMLLTEFLEPMGITQRTLADAIHVPYQRVNEI
FT                   INQKRGITPATALRLAKYFGMSADFWLNLQIRWDLYRSMQSEAKEIEAIQPLAS"
     MNIPTHRAPT HPGEMLLTEF LEPMGITQRT LADAIHVPYQ RVNEIINQKR GITPATALRL        60
     AKYFGMSADF WLNLQIRWDL YRSMQSEAKE IEAIQPLAS                               99
//

If you have problems or comments...

PBIL Back to PBIL home page