(data stored in ACNUC7421 zone)

EMBL: CP002355.PE384

CP002355.PE384       Location/Qualifiers
FT   CDS             382630..383202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0385"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1124 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component; InterPro IPR003439:
FT                   IPR003593; KEGG: tdn:Suden_0485 ABC transporter-related
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: ABC transporter-related protein; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33052"
FT                   /db_xref="GOA:E4TZ53"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ53"
FT                   /protein_id="ADR33052.1"
FT                   /translation="MNTVLDIENISFGYTKDILLFDNFSLSLKAGEIKAIVGPSGVGKS
FT                   TLFELILGHRKPLSGFIRSSSFSQVFQDPYSSFHPTYTVREQIKEVTSMEGYELLLEKM
FT                   GLEEAFLDSLPHKLSGGQLQRCSILRALLMKPKLLLLDEPTSALDNLNQLDIMKLIVDN
FT                   LEGMGVLLITHDGDLAAWCADEIVTLS"
     MNTVLDIENI SFGYTKDILL FDNFSLSLKA GEIKAIVGPS GVGKSTLFEL ILGHRKPLSG        60
     FIRSSSFSQV FQDPYSSFHP TYTVREQIKE VTSMEGYELL LEKMGLEEAF LDSLPHKLSG       120
     GQLQRCSILR ALLMKPKLLL LDEPTSALDN LNQLDIMKLI VDNLEGMGVL LITHDGDLAA       180
     WCADEIVTLS                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page