(data stored in ACNUC7421 zone)

EMBL: CP002355.PE386

CP002355.PE386       Location/Qualifiers
FT   CDS             complement(383886..385040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0488 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33054"
FT                   /db_xref="GOA:E4TZ55"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ55"
FT                   /protein_id="ADR33054.1"
FT                   /translation="MKALAFLFFFLGQILLAEPSVLTDPAPAPVTATEETTAAPTVETD
FT                   VNALFSGVSTTAGLTLQFSDLPSHPYVGEIIPVTVKLTPVDIASGNIEYTLQNEEGIRI
FT                   FSDTPRRSVKEDGVYDTFYFLVQSSSIRFPDITATLTSTGSVTEPLIGTALNAIPLSPP
FT                   SGFANVLADKFEVINYKTTPYNNESNVVIFTVKASRCNIGDFSIPNAIKQGFESKFSNV
FT                   GESQMTYYAIIPNTEQNLNFSFFNLKKQRYESIVIPIVVDDDTVSTQSDLSPTDARHTE
FT                   LKISAAAVVVAVLFGLFYWRRDKWYLYASSLPMFYIVYALLPNPTICVKKDAPIYLLPI
FT                   KNGTIFEMTLQEEHLEAEKEVGEFIKVHLDDKVGWVNKRDLCSN"
     MKALAFLFFF LGQILLAEPS VLTDPAPAPV TATEETTAAP TVETDVNALF SGVSTTAGLT        60
     LQFSDLPSHP YVGEIIPVTV KLTPVDIASG NIEYTLQNEE GIRIFSDTPR RSVKEDGVYD       120
     TFYFLVQSSS IRFPDITATL TSTGSVTEPL IGTALNAIPL SPPSGFANVL ADKFEVINYK       180
     TTPYNNESNV VIFTVKASRC NIGDFSIPNA IKQGFESKFS NVGESQMTYY AIIPNTEQNL       240
     NFSFFNLKKQ RYESIVIPIV VDDDTVSTQS DLSPTDARHT ELKISAAAVV VAVLFGLFYW       300
     RRDKWYLYAS SLPMFYIVYA LLPNPTICVK KDAPIYLLPI KNGTIFEMTL QEEHLEAEKE       360
     VGEFIKVHLD DKVGWVNKRD LCSN                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page