(data stored in ACNUC7421 zone)

EMBL: CP002355.PE387

CP002355.PE387       Location/Qualifiers
FT   CDS             complement(385037..385711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0388"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /EC_number="6.3.5.3"
FT                   /note="COGs: COG0047 Phosphoribosylformylglycinamidine
FT                   (FGAM) synthase glutamine amidotransferase domain; InterPro
FT                   IPR010075: IPR017926; KEGG: tdn:Suden_0489
FT                   phosphoribosylformylglycinamidine synthase I; PRIAM:
FT                   Phosphoribosylformylglycinamidine synthase; SPTR:
FT                   Phosphoribosylformylglycinamidine (FGAM) synthase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I; PFAM:
FT                   CobB/CobQ-like glutamine amidotransferase domain; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33055"
FT                   /db_xref="GOA:E4TZ56"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ56"
FT                   /protein_id="ADR33055.1"
FT                   /translation="MKVGIIQFPGTNCEYDTQHAFAALGCETQILWHKEDTIPSDMDLV
FT                   VAAGGFSYGDYLRSGAIAKMSPIMKALKVYAENGGKVLGICNGFQVLTETGLLPGALKR
FT                   NEGLHFISRHHHLKVINNDNIFLRHCNVDQVLNIPIAHHDGNFYIDEHGLQELYANGQV
FT                   LLKYTDEKGNIDNPNGSVDSIAGICNKSKNVFGLMPHPERAMETLLGSDDGKAMLEGFI
FT                   NA"
     MKVGIIQFPG TNCEYDTQHA FAALGCETQI LWHKEDTIPS DMDLVVAAGG FSYGDYLRSG        60
     AIAKMSPIMK ALKVYAENGG KVLGICNGFQ VLTETGLLPG ALKRNEGLHF ISRHHHLKVI       120
     NNDNIFLRHC NVDQVLNIPI AHHDGNFYID EHGLQELYAN GQVLLKYTDE KGNIDNPNGS       180
     VDSIAGICNK SKNVFGLMPH PERAMETLLG SDDGKAMLEG FINA                        224
//

If you have problems or comments...

PBIL Back to PBIL home page