(data stored in ACNUC7421 zone)

EMBL: CP002355.PE388

CP002355.PE388       Location/Qualifiers
FT   CDS             complement(385708..385950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0389"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="COGs: COG1828 Phosphoribosylformylglycinamidine
FT                   (FGAM) synthase PurS component; InterPro IPR003850; KEGG:
FT                   tdn:Suden_0490 phosphoribosylformylglycinamidine synthetase
FT                   PurS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; SPTR: Phosphoribosylformylglycinamidine synthetase
FT                   PurS; TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase; TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase, purS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33056"
FT                   /db_xref="GOA:E4TZ57"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ57"
FT                   /protein_id="ADR33056.1"
FT                   /translation="MKAIVNVFLKNGVLDSQGKAVQHALSGHGFETVKDVRVGKQIIIE
FT                   MNENDADAAKEKVAHMCEELLANTVIEDYEIEIQA"
     MKAIVNVFLK NGVLDSQGKA VQHALSGHGF ETVKDVRVGK QIIIEMNEND ADAAKEKVAH        60
     MCEELLANTV IEDYEIEIQA                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page