(data stored in ACNUC7421 zone)

EMBL: CP002355.PE390

CP002355.PE390       Location/Qualifiers
FT   CDS             complement(386668..387990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0391"
FT                   /product="carboxyl-terminal protease"
FT                   /note="COGs: COG0793 Periplasmic protease; InterPro
FT                   IPR004447: IPR001478: IPR005151; KEGG: tdn:Suden_0492
FT                   peptidase S41A, C-terminal protease; PFAM: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; SMART: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; SPTR: Periplasmic protease;
FT                   TIGRFAM: carboxyl-terminal protease; PFAM: Peptidase family
FT                   S41; PDZ domain (Also known as DHR or GLGF); TIGRFAM:
FT                   C-terminal peptidase (prc)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33058"
FT                   /db_xref="GOA:E4TZ59"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ59"
FT                   /protein_id="ADR33058.1"
FT                   /translation="MKNTKMMVVGFVSAVAVSLILSTSLFAKNTVAAPTEASVEASRLQ
FT                   SLAKFTKVLSIVEQYNVDGLTVDQLIDKSLQGMLSNLDAHSTYMDKKSYDNLKTQTDGE
FT                   FGGLGITVGMRDNALTVIAPIEGTPADKAGIKAGDIILKINDKSTLSMTIDDAVSIMRG
FT                   APKTPIDLTIVRKGLADPLKIHIIRDIITVQSVYTRNISGNILYIRVTSFDKKVAADVK
FT                   KAIKKYSGKSKGIILDLRNNPGGLLDQAVDLTDLFVDEGIIVSQKGRNKADDMTYKATK
FT                   SNTITDLPLVVLVNEGSASASEIVSGALQDLKRAVIVGEKTFGKGSVQVVMPITETEGI
FT                   KLTVARYYLPSGRTIQAVGVTPDIEVAAGEIKKHEKSFNIKEADLKEHLVSELEKSDGM
FT                   IDVTEANATNKTVITPEQMNRDIQLKEGVDIIKALIIVKGK"
     MKNTKMMVVG FVSAVAVSLI LSTSLFAKNT VAAPTEASVE ASRLQSLAKF TKVLSIVEQY        60
     NVDGLTVDQL IDKSLQGMLS NLDAHSTYMD KKSYDNLKTQ TDGEFGGLGI TVGMRDNALT       120
     VIAPIEGTPA DKAGIKAGDI ILKINDKSTL SMTIDDAVSI MRGAPKTPID LTIVRKGLAD       180
     PLKIHIIRDI ITVQSVYTRN ISGNILYIRV TSFDKKVAAD VKKAIKKYSG KSKGIILDLR       240
     NNPGGLLDQA VDLTDLFVDE GIIVSQKGRN KADDMTYKAT KSNTITDLPL VVLVNEGSAS       300
     ASEIVSGALQ DLKRAVIVGE KTFGKGSVQV VMPITETEGI KLTVARYYLP SGRTIQAVGV       360
     TPDIEVAAGE IKKHEKSFNI KEADLKEHLV SELEKSDGMI DVTEANATNK TVITPEQMNR       420
     DIQLKEGVDI IKALIIVKGK                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page