(data stored in ACNUC7421 zone)

EMBL: CP002355.PE391

CP002355.PE391       Location/Qualifiers
FT   CDS             complement(388069..388272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0392"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="COGs: COG2501 conserved hypothetical protein;
FT                   InterPro IPR002942; KEGG: tdn:Suden_1502 RNA-binding S4;
FT                   PFAM: RNA-binding S4 domain protein; SPTR: RNA-binding S4;
FT                   PFAM: S4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33059"
FT                   /db_xref="GOA:E4TZ60"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ60"
FT                   /protein_id="ADR33059.1"
FT                   /translation="MTYTLTEPFIELHKLIKLLDLVDTGGQAKMLIENGHVLRNGEVET
FT                   RKRAKITKGETIQIGDVVIEVV"
     MTYTLTEPFI ELHKLIKLLD LVDTGGQAKM LIENGHVLRN GEVETRKRAK ITKGETIQIG        60
     DVVIEVV                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page