(data stored in ACNUC7421 zone)

EMBL: CP002355.PE392

CP002355.PE392       Location/Qualifiers
FT   CDS             complement(388365..388637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0393"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="COGs: COG0724 RNA-binding protein (RRM domain);
FT                   InterPro IPR000504; KEGG: nis:NIS_0278 RNA-binding protein
FT                   RNP-1; PFAM: RNP-1 like RNA-binding protein; SMART: RNP-1
FT                   like RNA-binding protein; SPTR: RNA-binding protein RNP-1;
FT                   PFAM: RNA recognition motif. (a.k.a. RRM, RBD, or RNP
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33060"
FT                   /db_xref="GOA:E4TZ61"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ61"
FT                   /protein_id="ADR33060.1"
FT                   /translation="MTQIYVGNIPYGKDENDLKDLFGQYGEVSSVKFVNDKETGRFRGF
FT                   GFVEMANKDEADKAITALEGNDFGGRTLRVNEARPRAPRPPRDRW"
     MTQIYVGNIP YGKDENDLKD LFGQYGEVSS VKFVNDKETG RFRGFGFVEM ANKDEADKAI        60
     TALEGNDFGG RTLRVNEARP RAPRPPRDRW                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page